Potential Phishing domains for 2022-03-14
Share on:
Mar 15, 2022
Phishing
The following newly registered domains were flagged as potential candidates for phishing campaign hosting
- Copyright (c) 2021 JamesBrine
- Permission is hereby granted, free of charge, to any person obtaining a copy of this list to deal in the list without restriction, including without limtiation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the list, and to permit persons to whom the list is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies or substantial portions of the list.
- THE LIST IS PROVIDED ‘AS IS’, WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE LIST OR THE USE OR OTHER DEALINGS IN THE LIST.
NOTICE FOR REMOVAL
- This page is created automaticaly given several factors, textual similarity to known brands/companies, SSL certificate data and provider, open ports, domain registrar and registrant info, on-page content, correlation against prior confirmed phishing campaigns, and so forth. An effort has been made to reduce false positives by appending a score (0-10) using AI/ML modelling. If you believe that your website has been placed on this page by error, please contact me by email with the link above to be considered for removal.
Overview of Phishing Domains by Category
Scores are given from 0-10 using AI/ML, with higher numbers being more likely phishing domains. Domains that are undetermined may be reviewed later.
Facebook Phishing Domains
- facebook-instagram-mgmt.com Check certs : 1
- facebook-spy.com Check certs : 1
- facebookvsinstagram.com Check certs : 1
- facebookzh.com Check certs : 2
- fansenfacebook.com Check certs : 2
Instagram Phishing Domains
- facebook-instagram-mgmt.com Check certs : 1
- facebookvsinstagram.com Check certs : 1
- freestagram.com Check certs : 2
- instagram-bot.net Check certs : 1
- instagram-itiraz.com Check certs : 3
- instagram-rossiya.online Check certs : 2
- instagramapi.net Check certs : 1
- instagrambook247.com Check certs : 2
- instagrammix.xyz Check certs : 3
- instagramonlinebook.com Check certs : 2
- instagramonlinegames.com Check certs : 2
- lnstagram-ru.com Check certs : 1
- lnstagram.review Check certs : 2
- lnstagramreels.com Check certs : 1
- lnstagramru.com Check certs : 1
- reinstagram.com Check certs : 2
- tristagram.online Check certs : 3
- tristagram.xyz Check certs : 4
- tristagramm.com Check certs : 2
- tristagramm.online Check certs : 2
- xn–instagam-8ub.com Check certs : 1
- xn–instagram-vpb.com Check certs : 1
- z-instagram.online Check certs : 2
Twitter Phishing Domains
- 11twitter.com Check certs : 3
- twitter-checkout.com Check certs : 4
- twitter-private.com Check certs : 4
- twitter-register.com Check certs : 4
- twitter-safety.com Check certs : 4
- twitter-self.com Check certs : 4
- twitterbedavatakipci.xyz Check certs : 3
- twitterciksucretsiz.xyz Check certs : 3
- twitterfollow.com Check certs : 2
- ucretsiztwitterservisi.xyz Check certs : 3
Virus Phishing Domains
- malwarefo.com Check certs : 1
Support Phishing Domains
- aeru-suport.com Check certs : 2
- aeru-suport.net Check certs : 2
- agentsuporte.com Check certs : 3
- apichatsuporte.com Check certs : 3
- bespokedesigninterior.com Check certs : 3
- contapjsuporte.com Check certs : 1
- helpsuportes.com Check certs : 3
- kondesignindonesia.online Check certs : 2
- signinnext.com Check certs : 1
- signinslns.com Check certs : 1
- signinspark.com Check certs : 3
- suportdigiital.online Check certs : 2
- suportenetempresas.online Check certs : 1
- unapproved-review-signin.com Check certs : 5
- unnisuporte.com Check certs : 1
Login-Portal Phishing Domains
- 02login.online Check certs : 1
- 0kx-login.com Check certs : 2
- 7offerslogin.online Check certs : 3
- access-delogin.net Check certs : 1
- acessnovadaxlogin.com Check certs : 3
- auth-login.com Check certs : 1
- autodealerlogin.com Check certs : 3
- bitfinex-login.com Check certs : 2
- bitifinex-login.com Check certs : 5
- brimologin.online Check certs : 2
- drgomairilatonlogin.com Check certs : 1
- dropb0xxlogin.com Check certs : 1
- e-trans-login.ca Check certs : 2
- elgomairilatonlogin.com Check certs : 1
- geminilogin.net Check certs : 3
- gomairilatonlogin.com Check certs : 1
- gomairilatonloginbox.com Check certs : 1
- ingresa-login.com Check certs : 2
- lcloud-logins.online Check certs : 2
- login-mobile-greeting.com Check certs : 1
- login-update-japan-tokyong.com Check certs : 2
- loginapp.store Check certs : 1
- logindlc.com Check certs : 2
- loginjawaslot88.com Check certs : 2
- loginlost.com Check certs : 2
- loginmania.xyz Check certs : 4
- loginmarket.com Check certs : 2
- loginpsi138.com Check certs : 2
- logintogelhoki8.com Check certs : 3
- logln-aaxx.com Check certs : 2
- mstc23login.net Check certs : 3
- netflixx-login.com Check certs : 4
- paymath-login.net Check certs : 3
- primetvlogin.com Check certs : 2
- quickenlogin.com Check certs : 3
- ramlogin.com Check certs : 3
- ubs-login.com Check certs : 1
- uplanlogin.com Check certs : 2
- websoftlogin.xyz Check certs : 6
- yulmazlogin.com Check certs : 2
Office365 Phishing Domains
- office365vip.tech Check certs : 2
Microsoft Phishing Domains
- microsoftcloud.info Check certs : 3
Linkedin Phishing Domains
- bestoflinkedin.com Check certs : 3
- linkedinlocalizmir.com Check certs : 1
- linkedinvirtualassistant.com Check certs : 1
Dropbox Phishing Domains
- dropb0xxlogin.com Check certs : 1
- services-dropbox.com Check certs : 3
Adobe Phishing Domains
- adobecmm.com Check certs : 1
- bettysadobex.com Check certs : 3
- creativecloudmarketing.com Check certs : 2
- kazuyadobe.com Check certs : 3
- veryadobe.com Check certs : 1
Paypal Phishing Domains
- paypal-lock-case.com Check certs : 8
- paypal-lock-case.net Check certs : 5
- paypal-lock-centre.com Check certs : 1
- paypal-notice.net Check certs : 1
- paypal-security.tech Check certs : 1
- paypl-id-5270619320.life Check certs : 3
- paypl-id-5270619321.life Check certs : 3
- paypl-id-5270619322.life Check certs : 3
- paypl-id-5270619323.life Check certs : 3
- paypl-id-5270619324.life Check certs : 3
- paypl-id-5270619325.life Check certs : 3
- paypl-id-5270619326.life Check certs : 3
- paypl-id-5270619327.life Check certs : 3
- paypl-id-5270619328.life Check certs : 3
- paypl-id-5270619329.life Check certs : 3
- payplu.com Check certs : 1
- pppaypal.com Check certs : 5
- prioritiypayplus.site Check certs : 1
- serviceauth-paypal.com Check certs : 5
Amazon Phishing Domains
- about-amazon-sellers.com Check certs : 1
- about-amazon-selling.com Check certs : 1
- aboutamazonsellers.com Check certs : 1
- aboutamazonselling.com Check certs : 1
- amazon-jpn0so.com Check certs : 3
- amazon-jpn1so.com Check certs : 3
- amazon-jpn2so.com Check certs : 3
- amazon-ppe.com Check certs : 2
- amazondeserthotsprings.com Check certs : 1
- amazonfunds-cad.com Check certs : 1
- amazonhopping.com Check certs : 2
- amazoningcreatives.com Check certs : 1
- amazonions.com Check certs : 4
- amazonites.info Check certs : 4
- amazonlogon.com Check certs : 2
- amazonopoka.com Check certs : 3
- amazonprime.host Check certs : 2
- amazonsellerblog.com Check certs : 1
- amazonsma.com Check certs : 2
- amazonsupport-s.xyz Check certs : 3
- amazontawfeer.com Check certs : 3
- amazonworkersunited.com Check certs : 3
- bobsamazondiscounts.com Check certs : 2
- ce-amazon.com Check certs : 2
- contabilizaamazonas.com Check certs : 5
- corporateamazon.com Check certs : 3
- ikoloidamazon.com Check certs : 4
- legendamazon.com Check certs : 4
- notamazon.info Check certs : 3
- offamazondeals.com Check certs : 1
- rotic-amazon.com Check certs : 1
- shopamazon.me Check certs : 1
- updateacc-amazon.com Check certs : 1
Google Phishing Domains
- goglecookieplacementprivacysettlement.com Check certs : 2
- google-adwords.asia Check certs : 1
- googlece.com Check certs : 2
- googleeatth.com Check certs : 1
- googleexam.com Check certs : 2
- googlepaid.com Check certs : 1
- googles.tips Check certs : 4
- googleyq.com Check certs : 2
- sitekitbygoogle.com Check certs : 2
- whitegooglefox.xyz Check certs : 2
- yourgoogletrainer.com Check certs : 1
Banks Phishing Domains
- dhsbc.com Check certs : 1
- hsbc-deauthorise-payee.com Check certs : 2
- hsbcbc.com Check certs : 1
- hsbccreditcar.com Check certs : 1
- hsbccustomerc.com Check certs : 3
- hsbcdirec.com Check certs : 1
- hsbcpd.com Check certs : 1
- hsbcxalerts.com Check certs : 6
- michultrawellsfargochampionshipsweeps.com Check certs : 1
- redirect-wellsfargohelp.com Check certs : 2
- securewellsfargoresponse.com Check certs : 5
- wellsfargohelpcase.com Check certs : 9
- wellsfargohelpscase.com Check certs : 5
- wellsfargomortgagerefifraud.com Check certs : 1
- wellsfargorefiabuse.com Check certs : 1
- wellsfargorefifraud.com Check certs : 1
- wellsfargoresponse.com Check certs : 5
- westpaci.com Check certs : 2
Games Phishing Domains
- 6sixbox.com Check certs : 1
- auxboxte.xyz Check certs : 3
- blizzardbaits.com Check certs : 1
- blizzardpreworkout.com Check certs : 1
- boxbox.sbs Check certs : 3
- carelectricsgoldcoast.com Check certs : 3
- clxbox.com Check certs : 1
- csgokeo.xyz Check certs : 4
- csgonks.store Check certs : 3
- fortnitefel.site Check certs : 1
- fortnitescripts.com Check certs : 1
- minecraftgetpremium.com Check certs : 2
- mundoxbox.net Check certs : 2
- severcsgo.store Check certs : 3
- tibia-i.site Check certs : 3
- wp-csgo.com Check certs : 2
- www9minecraft.net Check certs : 3
- xboxbr.com Check certs : 1
- xboxtoken.online Check certs : 1
- zynga.life Check certs : 3
Crypto Phishing Domains
- binance-net.net Check certs : 2
- binance-network.com Check certs : 2
- binanceblockchainweektickets.com Check certs : 2
- binancebtc.online Check certs : 2
- binancecatcoin.com Check certs : 1
- binancecb.com Check certs : 1
- binancefb-trx.com Check certs : 1
- binancehq.com Check certs : 3
- binanceid.com Check certs : 2
- binanceprovip02.com Check certs : 2
- binanceza.site Check certs : 2
- binanceza.space Check certs : 2
- bitcoinbaseload.com Check certs : 3
- coinbase-trade.online Check certs : 2
- heycoinbasehireme.com Check certs : 3
- walletbinance.com Check certs : 3
Alibaba Phishing Domains
- alibabadid.com Check certs : 1
- allbabacloud.com Check certs : 2
- xn–alibabafrn-4ubb.com Check certs : 1
www Phishing Domains
- arganglowww.com Check certs : 0
- freewwway.com Check certs : 2
- httpwwwvai-vai-group.com Check certs : 3
- imtokenwww.com Check certs : 1
- izwww.com Check certs : 1
- legwww.com Check certs : 1
- papillonwww.xyz Check certs : 3
- www-1952.com Check certs : 1
- www-75849.com Check certs : 1
- www-hoo.xyz Check certs : 3
- www-lighting.com Check certs : 2
- www00636.com Check certs : 2
- www0078099.com Check certs : 2
- www10407.com Check certs : 1
- www22mmnn.com Check certs : 1
- www251991.com Check certs : 2
- www25371.com Check certs : 1
- www381ll.com Check certs : 1
- www42maoaa.com Check certs : 1
- www500vt.com Check certs : 1
- www520rr.com Check certs : 1
- www523u.com Check certs : 1
- www543hh.com Check certs : 1
- www588234.com Check certs : 1
- www5billionsales.com Check certs : 1
- www676ut.com Check certs : 1
- www703888.com Check certs : 2
- www77477.com Check certs : 1
- www779ut.com Check certs : 1
- www77aa.com Check certs : 1
- www875833.com Check certs : 2
- www876uy.com Check certs : 1
- www87qi.xyz Check certs : 2
- www87qm.xyz Check certs : 2
- www88segui.com Check certs : 1
- www8xth.com Check certs : 1
- www935833.com Check certs : 2
- www969ut.com Check certs : 1
- www99kk5.com Check certs : 1
- www99u79.xyz Check certs : 2
- www9minecraft.net Check certs : 3
- wwwaena.com Check certs : 3
- wwwaeta.com Check certs : 2
- wwwantonioprivate.com Check certs : 2
- wwwavatics.com Check certs : 3
- wwwbabyrus.com Check certs : 2
- wwwbaoyu1327.com Check certs : 1
- wwwbienestargob.com Check certs : 3
- wwwbigg.net Check certs : 1
- wwwbolt.com Check certs : 1
- wwwby6177.com Check certs : 1
- wwwcheguj.com Check certs : 2
- wwwcnaservizi.store Check certs : 2
- wwwcnzx.info Check certs : 3
- wwwconvertico.com Check certs : 3
- wwwecommetravel.com Check certs : 3
- wwwelectude.com Check certs : 2
- wwwfq36.xyz Check certs : 2
- wwwisteanim.site Check certs : 1
- wwwjsfco.com Check certs : 2
- wwwkidz.com Check certs : 2
- wwwknzu.online Check certs : 1
- wwwkpd3.com Check certs : 1
- wwwlhclhc.com Check certs : 2
- wwwmaverik.com Check certs : 2
- wwwmedmassager.com Check certs : 1
- wwwmizu.com Check certs : 2
- wwwokezone.com Check certs : 2
- wwwpereirakelson.com Check certs : 2
- wwwrayanair.com Check certs : 2
- wwwroot3qm6xlh2k.biz Check certs : 3
- wwwroot3s2mzfo2v.biz Check certs : 3
- wwwsat-gobmx-personasiniciarsesion-credentials.net Check certs : 2
- wwwtjshuntianshi.com Check certs : 1
- wwwtl777666.com Check certs : 2
- wwwttt565.com Check certs : 1
- wwwtvokids.com Check certs : 2
- wwwusopen.com Check certs : 2
- wwwvirgingames.com Check certs : 3
- wwwvirginia529.com Check certs : 2
- wwwww.tech Check certs : 1
- wwwx1c66.com Check certs : 1
- wwwx8h66.com Check certs : 1
- wwwx9j77.com Check certs : 1
- wwwx9k77.com Check certs : 1
- wwwxjizz.com Check certs : 1
- wwwxtime.com Check certs : 1
- wwwylhb.com Check certs : 1
- wwwzz12.com Check certs : 1
Zoom Phishing Domains
- airezoom.com Check certs : 3
- fasionzoom.xyz Check certs : 2
- jabberzoom.biz Check certs : 3
- sam9zoom.com Check certs : 2
- shoppezoom.online Check certs : 1
- taozoom.net Check certs : 1
- thezoomwedding.com Check certs : 1
- willzoomhk.com Check certs : 4
- z00m.online Check certs : 2
- z00mheatfitnezz.com Check certs : 3
- zoom52.com Check certs : 2
- zoomaccounts.net Check certs : 5
- zoombug.biz Check certs : 3
- zoomdive.biz Check certs : 3
- zoomerllc.com Check certs : 0
- zoomicmedia.com Check certs : 2
- zoomlightech.com Check certs : 3
- zoommycareer.com Check certs : 2
- zoomonline.club Check certs : 0
- zoomoutfit.net Check certs : 4
- zoomtoembody.com Check certs : 1
- zoomwithcmuchaw.com Check certs : 1
- zoomwithdrconstance.com Check certs : 1
Ryuk Phishing Domains
- 365onlinenetworksupport.com Check certs : 1
- 53helpsupport.com Check certs : 2
- 53infosupport.com Check certs : 6
- a-great-id-truck-driver-salaries.zone Check certs : 2
- a-great-us-cloud-storage-backup.zone Check certs : 2
- a-prime-th-truck-driver-salaries.zone Check certs : 2
- accounts-binanc-support.online Check certs : 6
- advernologysupport.com Check certs : 2
- aeru-support.com Check certs : 2
- airsupport.tech Check certs : 1
- alertraiffeisensupport.com Check certs : 1
- amazonsupport-s.xyz Check certs : 3
- appium-support.com Check certs : 1
- atbasesupport.tech Check certs : 3
- atozdrivers.com Check certs : 1
- att-employee-support.com Check certs : 5
- avitalitysupport.com Check certs : 3
- azudriver.store Check certs : 3
- backupjedi.xyz Check certs : 2
- backupnotary.com Check certs : 1
- basesupport.tech Check certs : 3
- blockchain-support.net Check certs : 2
- busniess-communitys-supports.xyz Check certs : 3
- bw572backup.xyz Check certs : 2
- bw573backup.xyz Check certs : 2
- bytesizesupport.com Check certs : 2
- codetechsupport.com Check certs : 2
- coldrivermountain.com Check certs : 1
- dell-driver-download.com Check certs : 1
- delldriverscentre.com Check certs : 2
- driver-job.site Check certs : 2
- driverapponlie.com Check certs : 1
- driverobservan.store Check certs : 1
- drivers-day.com Check certs : 3
- driverseddirec.com Check certs : 1
- driversjoy.store Check certs : 2
- dxsupport.net Check certs : 3
- eltorogozdrivers.com Check certs : 3
- employee-support.com Check certs : 4
- exact-support.online Check certs : 2
- express-driver-license.com Check certs : 4
- facturationsupport.com Check certs : 2
- fbsupports.com Check certs : 3
- financialsupport.loan Check certs : 1
- find-my-supportt.com Check certs : 3
- fmi-support-fmi.com Check certs : 6
- fmi-support-secure.com Check certs : 3
- fordsupport.com Check certs : 3
- forestbackups.com Check certs : 2
- frc-all-music-support.online Check certs : 3
- goodsupport.store Check certs : 2
- highsupport.biz Check certs : 3
- homealertsupport.net Check certs : 2
- inclusivesupport.store Check certs : 2
- karmabackup.com Check certs : 1
- lhmysupport.com Check certs : 3
- livelychatsupport.com Check certs : 2
- lsupport-ld.site Check certs : 1
- macsmbsupport.com Check certs : 2
- metamask-support-connect.com Check certs : 2
- moderator-safefy-support.com Check certs : 2
- moolahsupport.com Check certs : 1
- msgsupports.com Check certs : 3
- msupport.tech Check certs : 2
- mtmsupport.com Check certs : 2
- myedusupport.com Check certs : 3
- myquickbooks-support.com Check certs : 1
- mytherapysupport.com Check certs : 3
- needysupport.biz Check certs : 3
- netflixsupportclient05.info Check certs : 3
- noreplys-supports.com Check certs : 3
- offsitebackupapp.com Check certs : 2
- oilfielddrivertraining.com Check certs : 0
- okta-support.net Check certs : 3
- ota-pcsupport.com Check certs : 3
- peersupportpal.com Check certs : 3
- photocubebackup.com Check certs : 3
- pointinfo-support.com Check certs : 2
- psychologicalsupportforukraine.com Check certs : 3
- quick4support.com Check certs : 1
- redrivereldt.com Check certs : 1
- refrigeratedtruckdriver.com Check certs : 2
- rokusupportnow.com Check certs : 2
- roybackup.xyz Check certs : 2
- samzugawalletbackup.online Check certs : 2
- setsupport.online Check certs : 2
- singlesessionsupport.com Check certs : 4
- smbxsupport.com Check certs : 2
- specific-support.online Check certs : 3
- spk-technical-support.com Check certs : 2
- support-aibsecure.com Check certs : 5
- support-cosbar.com Check certs : 2
- support-ig.com Check certs : 3
- support-mania.com Check certs : 4
- support-no-reply-verification.com Check certs : 1
- support-wcs.com Check certs : 1
- support-zendesk.com Check certs : 2
- support1011.com Check certs : 1
- supportadv.com Check certs : 2
- supportforums-db.com Check certs : 2
- supportfunds2.com Check certs : 2
- supportgetwebzo.online Check certs : 1
- supportingribbons.com Check certs : 2
- supportinvestors.com Check certs : 2
- supportourtruckerstshirt.com Check certs : 1
- supports-fb.com Check certs : 3
- supportservicehelpline.com Check certs : 2
- supportshot.com Check certs : 2
- supportsnappy.online Check certs : 2
- supporttransyouth.com Check certs : 1
- supportukraine.space Check certs : 3
- swift-support.online Check certs : 2
- taxsupportcenters.com Check certs : 2
- technosupport-co-jp.com Check certs : 2
- thecanondriver.com Check certs : 3
- thecareersupport.com Check certs : 2
- thesesupportroom.xyz Check certs : 5
- traindrivers.online Check certs : 2
- truckdriversjobs.site Check certs : 1
- ubuddrivers.com Check certs : 4
- unite-support.com Check certs : 3
- unitedairlinessupport.com Check certs : 3
- unitingdrivers.com Check certs : 2
- unitingdrivers.online Check certs : 1
- upwardriver.online Check certs : 1
- venuesupport.store Check certs : 2
- windowssupport.online Check certs : 4
- wyiksupport.com Check certs : 4
Onlyfans Phishing Domains
- famousonlyfans4.com Check certs : 4
- famousonlyfans5.com Check certs : 4
- famousonlyfans6.com Check certs : 3
- onlyfans.pictures Check certs : 2
- onlyfansnft.xyz Check certs : 2
- onlyfansphotography.net Check certs : 1