Potential Phishing domains for 2022-10-18
Share on:
Oct 19, 2022
Phishing
The following newly registered domains were flagged as potential candidates for phishing campaign hosting
- Copyright (c) 2021 JamesBrine
- Permission is hereby granted, free of charge, to any person obtaining a copy of this list to deal in the list without restriction, including without limtiation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the list, and to permit persons to whom the list is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies or substantial portions of the list.
- THE LIST IS PROVIDED ‘AS IS’, WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE LIST OR THE USE OR OTHER DEALINGS IN THE LIST.
NOTICE FOR REMOVAL
- This page is created automaticaly given several factors, textual similarity to known brands/companies, SSL certificate data and provider, open ports, domain registrar and registrant info, on-page content, correlation against prior confirmed phishing campaigns, and so forth. An effort has been made to reduce false positives by appending a score (0-10) using AI/ML modelling. If you believe that your website has been placed on this page by error, please contact me by email with the link above to be considered for removal.
Overview of Phishing Domains by Category
Scores are given from 0-10 using AI/ML, with higher numbers being more likely phishing domains. Domains that are undetermined may be reviewed later.
Facebook Phishing Domains
- facebookbusinessmeta.com Check certs : 2
- facebookmanagement.com Check certs : 2
- facebooksecuremail.com Check certs : 3
- notmyfacebookpage.com Check certs : 2
Instagram Phishing Domains
- 8instagram.com Check certs : 3
- adultinstagram.com Check certs : 2
- bluetickbyinstagram.com Check certs : 2
- followersoninstagram.com Check certs : 2
- instagramistanbulescort.com Check certs : 1
- instagramrocket.com Check certs : 3
- login-instagram.store Check certs : 6
- magainstagram.com Check certs : 2
- photos-secret-lnstagram.com Check certs : 3
- topstagram.com Check certs : 3
Twitter Phishing Domains
- hacktwitter.xyz Check certs : 4
- moneytwitter.com Check certs : 2
- twitterceojackdorsey.com Check certs : 2
- twittercopyright.com Check certs : 10
- twitterescort.com Check certs : 2
- twitteristanbulescort.com Check certs : 1
- twittermediadownloader.com Check certs : 1
Virus Phishing Domains
- malwarebytes-download.click Check certs : 2
- malwarebytes-download.digital Check certs : 2
- malwarebytes-download.live Check certs : 2
- malwarebytes-download.one Check certs : 2
- malwarebytes-download.online Check certs : 1
- malwarebytes-download.org Check certs : 3
- malwarebytes-download.pro Check certs : 2
Support Phishing Domains
- 1bmo-sign-in-mobile.com Check certs : 9
- 2ksuport.com Check certs : 2
- appsuportti.com Check certs : 2
- cadesigninterior.com Check certs : 3
- coinbase-signin.com Check certs : 2
- credito-agricola-suporte.site Check certs : 3
- eldermarksuport.com Check certs : 3
- idmy-signin.com Check certs : 2
- lcloud-signin.live Check certs : 2
- netbank-suport.com Check certs : 5
- online-bmo-sign-in.com Check certs : 10
- paypallsuportinfo.com Check certs : 4
- sign-ini.cloud Check certs : 8
- signin-i.cloud Check certs : 3
- signinads.com Check certs : 3
- suncoast-account-signin.com Check certs : 7
- suporte-creditoagricola.site Check certs : 3
- suporteonlineamarelo.com Check certs : 2
- website-design-india.xyz Check certs : 7
- zon-signin-page-auth-88759.shop Check certs : 1
- zon-signin-pape-max-auth.com Check certs : 2
Login-Portal Phishing Domains
- 1bmo-myapp-login.com Check certs : 10
- aeoonelogin.com Check certs : 7
- allin1login.com Check certs : 7
- aplus0netstation2step0login.com Check certs : 10
- app-gerenciacxlogin.com Check certs : 7
- app-gerencialogincx.com Check certs : 7
- applewebobjectslogin.net Check certs : 7
- atdonlinelogin.com Check certs : 7
- banking-axos-login.com Check certs : 7
- blogincu.com Check certs : 7
- blogingdudes.com Check certs : 8
- blogingkingdomusa.com Check certs : 9
- bluemountainlogin.com Check certs : 7
- bmo-login-myapp.com Check certs : 9
- clientzone-afrihost-login.com Check certs : 9
- climateclogin.com Check certs : 6
- climateclogln.com Check certs : 1
- cloginfo.com Check certs : 10
- comperconalmemberlwploginlnotify.shop Check certs : 6
- comperconalmemberlwploginlrefresh.shop Check certs : 6
- comperconalmemberlwploginlswitch.shop Check certs : 6
- comperconalmemberlwploginlupdate.shop Check certs : 6
- confirmlogin-secure.com Check certs : 6
- crickblogindia.com Check certs : 8
- dkb-login.com Check certs : 6
- fireleaguelogin.com Check certs : 10
- firstsavingscreditcardlogin.com Check certs : 7
- gagovlogin.com Check certs : 7
- govunemploymentbenefitslogin.com Check certs : 7
- gtelogln.online Check certs : 2
- happylifelogin.com Check certs : 7
- ikbr-login.com Check certs : 6
- imaginelearninglogin.com Check certs : 7
- instan2netstation2step1login.com Check certs : 10
- kpktotologin.com Check certs : 6
- linktaulogin.link Check certs : 10
- ljsd-zhj-wegame-login.com Check certs : 7
- login-bmoharris.com Check certs : 8
- login-erstebanka-hu.bond Check certs : 10
- login-galagames-apk.com Check certs : 8
- login-instagram.store Check certs : 6
- login-pekao24.com Check certs : 8
- login-secure.online Check certs : 6
- login-webservice.com Check certs : 9
- loginboa.online Check certs : 7
- logindispositivoweb.com Check certs : 7
- loginfungame777.com Check certs : 7
- loginkkslot777.com Check certs : 7
- loginovanastya.online Check certs : 7
- loginsmd.live Check certs : 7
- loginultpro.com Check certs : 7
- loluplogin.click Check certs : 8
- mooneylogin.info Check certs : 8
- netstation2init5aplus7login.com Check certs : 7
- officelogin.org Check certs : 7
- panelistlogin.com Check certs : 8
- robinhood-online-login.com Check certs : 7
- ronorp-login.org Check certs : 7
- secure-accounts-loginss.com Check certs : 6
- secure-login-mygovau.com Check certs : 10
- securelogin-mygov.com Check certs : 6
- sellercentral-d0mains-login.one Check certs : 7
- step9netstation2aplus5login.com Check certs : 10
- suncoast-account-login.com Check certs : 7
- targetredcardpaymentlogin.com Check certs : 7
- techlogin.live Check certs : 8
- telusinternationalonelogin.com Check certs : 7
- txadminlogin.net Check certs : 8
- wdpedia-adminlogin.com Check certs : 7
- westpack-login.com Check certs : 7
- wwwlogin-scotiaonline.com Check certs : 9
- xn–logln-bcr-r-489e.com Check certs : 3
Microsoft Phishing Domains
- 548925bbc36df6ce49012emorristileonmicrosoft.com Check certs : 3
- broadheadco-microsoftonline.com Check certs : 3
- clerisy-group-onmicrosoft.com Check certs : 1
- developermicrosoft.com Check certs : 2
- mail2serv01-leadrshprd06egjty-microsft.com Check certs : 3
- microsoft-cloudsecurity.com Check certs : 2
- microsoft-portugal.com Check certs : 2
- microsoft335.com Check certs : 2
- microsoft362.com Check certs : 2
- microsoft368.com Check certs : 2
- microsoft36r.com Check certs : 2
- microsoft36t.com Check certs : 2
- microsoft395.com Check certs : 2
- microsoft3t5.com Check certs : 2
- microsoft3y5.com Check certs : 2
- microsoft665.com Check certs : 2
- microsoftbd.com Check certs : 2
- microsofte65.com Check certs : 2
- microsoftfr.com Check certs : 2
- microsoftfrance.com Check certs : 5
- microsoftintune.guru Check certs : 2
- microsoftsolutiononlineupdate.live Check certs : 2
- microsoftupdateonlinesolution.live Check certs : 3
- microsoftw65.com Check certs : 2
- microsoftwindowdefender.com Check certs : 3
- mybuildmicrosoft.com Check certs : 2
- onmicrosoftnepal.com Check certs : 1
- sutis-5trst-us10-microsoft-exchange365.com Check certs : 3
Linkedin Phishing Domains
- linkedinevents.online Check certs : 2
Dropbox Phishing Domains
- dropbox1.com Check certs : 2
Adobe Phishing Domains
- adobesign-online.com Check certs : 2
- adobeveldt.site Check certs : 2
- get-adobereader.com Check certs : 3
Paypal Phishing Domains
- gmailpaypal.com Check certs : 2
- palpayrewards.com Check certs : 2
- paypalasistances.com Check certs : 3
- paypalcare.com Check certs : 2
- paypalcheckserv.com Check certs : 3
- paypalcsinfo.com Check certs : 4
- paypaleewards.com Check certs : 2
- paypalewards.com Check certs : 2
- paypalinfocs.com Check certs : 4
- paypall.website Check certs : 1
- paypallhellpinformations.com Check certs : 4
- paypallinformation.com Check certs : 4
- paypallinformationservs.com Check certs : 4
- paypallnfo.com Check certs : 3
- paypallreviews.com Check certs : 3
- paypallreviewss.com Check certs : 3
- paypallreviiews.com Check certs : 3
- paypallrewards.com Check certs : 2
- paypallservice.com Check certs : 3
- paypallservsalertrss.com Check certs : 3
- paypallsuportinfo.com Check certs : 4
- paypallupdate.com Check certs : 6
- paypalreards.com Check certs : 2
- paypalreawrds.com Check certs : 2
- paypalreeards.com Check certs : 2
- paypalreewards.com Check certs : 2
- paypalreqards.com Check certs : 2
- paypalrewaards.com Check certs : 2
- paypalrewads.com Check certs : 2
- paypalrewaeds.com Check certs : 2
- paypalreward.com Check certs : 2
- paypalrewarda.com Check certs : 2
- paypalrewardd.com Check certs : 2
- paypalrewardds.com Check certs : 2
- paypalrewarfs.com Check certs : 2
- paypalrewarrds.com Check certs : 2
- paypalrewars.com Check certs : 2
- paypalrewarss.com Check certs : 2
- paypalrewatds.com Check certs : 2
- paypalrewrads.com Check certs : 2
- paypalrewrds.com Check certs : 2
- paypalrewsrds.com Check certs : 2
- paypalrewwards.com Check certs : 2
- paypalrrewards.com Check certs : 2
- paypalrrwards.com Check certs : 2
- paypalrwards.com Check certs : 2
- paypalrwwards.com Check certs : 2
- paypaltewards.com Check certs : 2
- payplarewards.com Check certs : 2
- payplrewards.com Check certs : 2
- ppaypalrewards.com Check certs : 2
- toppayplay.com Check certs : 4
- wwwpaypalrewards.com Check certs : 2
Amazon Phishing Domains
- accessedamazon.com Check certs : 1
- accountamazon.info Check certs : 8
- amazon-918.com Check certs : 2
- amazon-cc.info Check certs : 6
- amazon-pc.mom Check certs : 2
- amazonasgraficarapida.com Check certs : 2
- amazonationmarket.com Check certs : 3
- amazoncarto.com Check certs : 3
- amazonck.vip Check certs : 2
- amazoncom.fun Check certs : 1
- amazoncommy-tv.com Check certs : 3
- amazondance.com Check certs : 2
- amazonenews.com Check certs : 2
- amazonfindr.com Check certs : 2
- amazonflexdeliveries.com Check certs : 2
- amazoniahotelsolutions.com Check certs : 2
- amazonm.monster Check certs : 2
- amazonmonica.com Check certs : 2
- amazonmusiclive.com Check certs : 1
- amazonretaliations.com Check certs : 2
- amazonsellercfo.com Check certs : 2
- amazonsellerloadboard.com Check certs : 2
- amazontrust.site Check certs : 1
- amazontw.shop Check certs : 1
- aop3dgamezon.com Check certs : 4
- audiovideoamazon.com Check certs : 2
- auths2famangeamazon.com Check certs : 2
- backupamazon.com Check certs : 4
- camazons.com Check certs : 2
- caseidhotamazon.com Check certs : 6
- consoletableamazon.com Check certs : 2
- csamazonfrozen.com Check certs : 3
- csamazoninfo.com Check certs : 4
- flash-amazon.com Check certs : 2
- floramezon.com Check certs : 4
- hiringjobamazon.com Check certs : 2
- kaliiniajaceceamazon.com Check certs : 1
- my-amazon.live Check certs : 3
- parentalcontrolamazon.com Check certs : 2
- salvaelamazonas.com Check certs : 4
- samazonhelpscenter.com Check certs : 3
- sevicesamazon.com Check certs : 1
- smile-amazonprime.com Check certs : 3
- startacareertodayamazon.com Check certs : 3
- textilamazonas.online Check certs : 1
- thesobsusahzamazon.com Check certs : 2
- update-amazon.shop Check certs : 1
- usdamazon.com Check certs : 3
- weamazon.org Check certs : 2
- webbamazonmarketing.com Check certs : 2
- zelvaamazonnikkei.com Check certs : 3
Google Phishing Domains
- ads-google.org Check certs : 8
- buygooglenest.com Check certs : 2
- freegoogleplaygiftcards.com Check certs : 2
- goglekresbu.monster Check certs : 2
- googie.run Check certs : 2
- google-drive.online Check certs : 3
- googledating.com Check certs : 2
- googleguardians.com Check certs : 2
- googleisyourresume.net Check certs : 2
- googlemy.homes Check certs : 1
- googlemy.house Check certs : 2
- googlenewsapproval.com Check certs : 3
- googleprestige.com Check certs : 2
- googlesecurityproducts.com Check certs : 2
- googleslidesacademy.com Check certs : 2
- googlesmart.homes Check certs : 1
- googlesmart.house Check certs : 2
- googlesmarthouse.com Check certs : 2
- googlesmartsecurity.com Check certs : 2
- googlewax.com Check certs : 2
- googleyantra.com Check certs : 1
- howtorankhigherongoogle.com Check certs : 2
- kantingoogle.com Check certs : 2
- okgoogle.org Check certs : 2
- pay-googlecom.com Check certs : 2
- paygooglecom.com Check certs : 2
- phan-anh-tattoo-google-tim-kiem.site Check certs : 1
- pleyejgoogle.space Check certs : 2
- safecloud-google.com Check certs : 3
Banks Phishing Domains
- careersatwellsfargo.com Check certs : 1
- hsbc-acc.com Check certs : 2
- hsbconlineuk.com Check certs : 2
- unicredit.pro Check certs : 3
- unicreditbank-new.info Check certs : 4
- verify-wellsfargo.com Check certs : 9
- wellsfargo-apps.com Check certs : 4
- wellsfargo-signon.com Check certs : 4
- wellsfargoltd.info Check certs : 3
- westpacinvest.online Check certs : 3
- westpack-login.com Check certs : 7
- wfhomepreservationsupportwellsfargo.com Check certs : 2
Games Phishing Domains
- archangeltibia.online Check certs : 3
- blizzard-wow.com Check certs : 1
- csgo-case.pro Check certs : 7
- csgocase.pro Check certs : 7
- csgoemp.com Check certs : 2
- csgofarm.online Check certs : 2
- csgomama.com Check certs : 2
- csgor2.run Check certs : 2
- doplexbox.site Check certs : 1
- fashionweekfortnite.com Check certs : 2
- fortnitefashionweek.com Check certs : 2
- fortnitefunonly4you.info Check certs : 3
- getpixbox.com Check certs : 3
- htpsfortnite.com Check certs : 2
- legendsminecraft.com Check certs : 2
- minecraft-plugin.store Check certs : 2
- minecraftblogs.com Check certs : 1
- minecraftbuildingconsultants.com Check certs : 3
- minecraftlegendss.com Check certs : 2
- minecraftrain.org Check certs : 2
- noxbox.biz Check certs : 2
- noxbox.online Check certs : 1
- patitasfortnite.com Check certs : 2
- picsgood.com Check certs : 1
- sirkatibiakademi.com Check certs : 2
- solominecraft.com Check certs : 3
- tibiaglobal.online Check certs : 2
- xboxemail.com Check certs : 2
- xboxgiftcardcode.com Check certs : 3
- xboxnerds.com Check certs : 1
Crypto Phishing Domains
- accountrecover-coinbase.com Check certs : 7
- binance-aus.com Check certs : 5
- binance-gives.org Check certs : 2
- binance-it.com Check certs : 2
- binance-smart-chain.link Check certs : 2
- binance-smart-chain.vip Check certs : 2
- binance-smart-chain.work Check certs : 2
- binance-smart-contract.buzz Check certs : 2
- binance-team.info Check certs : 3
- binanceeventtakipleri.net Check certs : 2
- binancefirsat.net Check certs : 2
- binancemiller.com Check certs : 3
- binancemiller.online Check certs : 1
- binancemiller.store Check certs : 2
- cancel3465-binance.com Check certs : 5
- coinbase-net.com Check certs : 2
- coinbase-signin.com Check certs : 2
- coinbasemart.info Check certs : 3
- coinbaseregulation.info Check certs : 3
- coinbasetrades.com Check certs : 2
- ecoinbase.net Check certs : 1
- firsatbinance.net Check certs : 2
- mybinancechain.com Check certs : 1
- nl-binance.com Check certs : 5
- pancakeswapy.com Check certs : 3
- reverifycoinbase.info Check certs : 8
- skybinance.com Check certs : 3
- strongholdwalllets.com Check certs : 2
- support-procoinbase.com Check certs : 3
- team-binance.info Check certs : 3
- verify-binance.info Check certs : 10
- wm-coinbase.xyz Check certs : 3
Alibaba Phishing Domains
- bangalibaba.net Check certs : 2
- oezalibaba.com Check certs : 2
- traslatehalibaba.com Check certs : 2
www Phishing Domains
- codewww.com Check certs : 1
- eee1www.life Check certs : 2
- eee2www.life Check certs : 2
- hhhwww111.xyz Check certs : 2
- hhhwww222.xyz Check certs : 2
- httpwww19thtakeout.com Check certs : 3
- iwwwk.com Check certs : 1
- lyjcwww.com Check certs : 1
- wild-www-turkey.com Check certs : 3
- www-192-168-0-1.com Check certs : 1
- www-27365.com Check certs : 2
- www-44930.com Check certs : 2
- www-500pj.com Check certs : 1
- www-801.com Check certs : 1
- www-88930.com Check certs : 2
- www-arab.com Check certs : 3
- www-basvuru-iphone-teb.net Check certs : 1
- www-basvuruiphone-teb.net Check certs : 1
- www-bitget-com.online Check certs : 3
- www-bitkub.net Check certs : 5
- www-eng.com Check certs : 3
- www-fars.com Check certs : 3
- www-hyperbolicstretching.com Check certs : 2
- www-kurd.com Check certs : 3
- www-lang.com Check certs : 3
- www-ledgerlive.com Check certs : 3
- www-mastercard.online Check certs : 2
- www-nb6.com Check certs : 2
- www-notes.com Check certs : 3
- www-robinhood.com Check certs : 2
- www-scotiasummary.com Check certs : 5
- www-turk.com Check certs : 3
- www001233.com Check certs : 3
- www0606kk.com Check certs : 1
- www062433.com Check certs : 2
- www105944.com Check certs : 2
- www109244.com Check certs : 2
- www1122vip1.com Check certs : 2
- www118096.com Check certs : 2
- www118bet.com Check certs : 2
- www153902.com Check certs : 2
- www166039.com Check certs : 2
- www16hd.net Check certs : 2
- www17020.com Check certs : 2
- www1www.life Check certs : 2
- www2479x.com Check certs : 2
- www262689.com Check certs : 2
- www2662j.com Check certs : 2
- www2www.life Check certs : 2
- www324zh.com Check certs : 1
- www331144c.com Check certs : 2
- www334411commwww3344111.com Check certs : 2
- www345848.com Check certs : 2
- www3632k.com Check certs : 2
- www3874x.com Check certs : 2
- www3www.life Check certs : 2
- www410244.com Check certs : 2
- www417044.com Check certs : 2
- www4234p.com Check certs : 2
- www424224.com Check certs : 2
- www429344.com Check certs : 2
- www431744.com Check certs : 2
- www431844.com Check certs : 2
- www44116668.com Check certs : 2
- www44930.com Check certs : 2
- www474733.com Check certs : 2
- www494449.com Check certs : 2
- www494994.com Check certs : 2
- www498044.com Check certs : 2
- www4www.life Check certs : 2
- www50922.com Check certs : 1
- www50922v.com Check certs : 1
- www510583.com Check certs : 2
- www5127t.com Check certs : 2
- www51vip13.com Check certs : 2
- www525290.com Check certs : 2
- www5414vip.com Check certs : 2
- www54151.vip Check certs : 2
- www5454n.com Check certs : 2
- www55229.com Check certs : 1
- www55618y.com Check certs : 2
- www5581bet.com Check certs : 2
- www55995x.com Check certs : 2
- www5844p.com Check certs : 2
- www5859t.com Check certs : 1
- www5919s.com Check certs : 2
- www59k59.com Check certs : 2
- www60094.com Check certs : 2
- www61320088.com Check certs : 2
- www6499n.com Check certs : 2
- www6686j.com Check certs : 1
- www6686p4.com Check certs : 2
- www67229p.com Check certs : 2
- www678272.com Check certs : 2
- www6938n.com Check certs : 1
- www811812.com Check certs : 1
- www817010.com Check certs : 2
- www835757.com Check certs : 2
- www837265.com Check certs : 2
- www844bets10.com Check certs : 1
- www845bets10.com Check certs : 1
- www847bets10.com Check certs : 2
- www852cc.com Check certs : 1
- www863363.com Check certs : 2
- www880847.com Check certs : 2
- www88352.com Check certs : 1
- www8868y17.com Check certs : 2
- www895144.com Check certs : 2
- www8x88x.com Check certs : 1
- www903434.com Check certs : 2
- www91019.com Check certs : 1
- www92220517.com Check certs : 2
- www945cai.com Check certs : 2
- www973cf.com Check certs : 2
- www979644.com Check certs : 2
- www993220.com Check certs : 2
- www995059.com Check certs : 2
- www9988xinpujing.com Check certs : 2
- wwwadbanker.com Check certs : 1
- wwwairspace.com Check certs : 2
- wwwairwallex.com Check certs : 2
- wwwapp64068.com Check certs : 2
- wwwarmstrongair.com Check certs : 2
- wwwav052.com Check certs : 2
- wwway.fun Check certs : 1
- wwwb5392.com Check certs : 2
- wwwbestonlinecabinets.com Check certs : 2
- wwwbet727.com Check certs : 2
- wwwbetnano1365.com Check certs : 2
- wwwbetnano1365.xyz Check certs : 2
- wwwbetpark572.com Check certs : 3
- wwwbetpark572.xyz Check certs : 2
- wwwbetturkey732.com Check certs : 2
- wwwbetturkey733.com Check certs : 2
- wwwbmw1157.com Check certs : 2
- wwwbob8.com Check certs : 2
- wwwbob888.com Check certs : 2
- wwwboltdepot.com Check certs : 2
- wwwboostoxygen.com Check certs : 2
- wwwbty8100.com Check certs : 2
- wwwbway20.com Check certs : 2
- wwwc788gd.com Check certs : 2
- wwwcasualdating.com Check certs : 2
- wwwcc44555.com Check certs : 2
- wwwchamberlaingroup.com Check certs : 2
- wwwclimatec.com Check certs : 1
- wwwclothingfuel.shop Check certs : 3
- wwwconedisonsmartenergyplan.com Check certs : 2
- wwwcrimescenephotos.com Check certs : 2
- wwwcxwt244.com Check certs : 2
- wwwdakaractu.com Check certs : 3
- wwwdemirkayavhavensettlement.com Check certs : 2
- wwwdentakay.com Check certs : 2
- wwwdollarsavingsdirect.com Check certs : 2
- wwwdrivalia.com Check certs : 2
- wwwdszb18.com Check certs : 2
- wwwe8386.com Check certs : 2
- wwwe9663.com Check certs : 2
- wwweabuilder.com Check certs : 2
- wwwebb666.com Check certs : 1
- wwwexploreuhc.com Check certs : 2
- wwwfhtyvip588.com Check certs : 2
- wwwforeclosurelisting.com Check certs : 1
- wwwgeauxvote.com Check certs : 2
- wwwgotoworkhappy.com Check certs : 2
- wwwgriffincapital.com Check certs : 2
- wwwhhy.com Check certs : 2
- wwwim175.com Check certs : 2
- wwwj5968.com Check certs : 2
- wwwjd1088.com Check certs : 2
- wwwjoincambridge.com Check certs : 2
- wwwjs704.com Check certs : 2
- wwwjs781.com Check certs : 2
- wwwkcc69.com Check certs : 2
- wwwklc3003.com Check certs : 2
- wwwlogin-scotiaonline.com Check certs : 9
- wwwmarsbahis976.com Check certs : 4
- wwwmarsbahis977.com Check certs : 1
- wwwmarsbahis978.com Check certs : 1
- wwwmdhearing.com Check certs : 2
- wwwmedigold.com Check certs : 2
- wwwmir.com Check certs : 3
- wwwmisschocolate.com Check certs : 2
- wwwmizecpas.com Check certs : 2
- wwwmk828.com Check certs : 2
- wwwmozilla.org Check certs : 2
- wwwmymaa.com Check certs : 1
- wwwmypayment.com Check certs : 7
- wwwnashpainthingservice.net Check certs : 3
- wwwniuniuzhifu.xyz Check certs : 3
- wwwordercp.com Check certs : 2
- wwwoverheadlabasin.com Check certs : 2
- wwwpaypalrewards.com Check certs : 2
- wwwpeaceloveworld.com Check certs : 2
- wwwpremiermtg.com Check certs : 2
- wwwpsychologyjunkie.com Check certs : 2
- wwwqy8881.com Check certs : 2
- wwwrementor.com Check certs : 2
- wwwrentreporters.com Check certs : 2
- wwwresinwerks.com Check certs : 2
- wwwsahabet355.com Check certs : 2
- wwwsierracentral.com Check certs : 2
- wwwskincare.net Check certs : 4
- wwwsweetmeet.com Check certs : 2
- wwwt89082.com Check certs : 2
- wwwtest.org Check certs : 2
- wwwtheowlclub.com Check certs : 2
- wwwtomi.digital Check certs : 2
- wwwtranehome.com Check certs : 1
- wwwtristateortho.com Check certs : 2
- wwwtyc83007.com Check certs : 2
- wwwu5622.com Check certs : 2
- wwwubercarshare.com Check certs : 2
- wwwudldti.com Check certs : 2
- wwwv72559.com Check certs : 2
- wwwville.com Check certs : 2
- wwwwaitstuff.com Check certs : 2
- wwwwebofscience.com Check certs : 2
- wwwwestwaysstaffing.com Check certs : 2
- wwwwithu.com Check certs : 2
- wwwwns464.com Check certs : 2
- wwwx28889.com Check certs : 2
- wwwyardibreeze.com Check certs : 2
- wwwyasehub.com Check certs : 3
- wwwyh75764.com Check certs : 2
- wwwyouimpact.com Check certs : 2
- wwwyyhgames.com Check certs : 2
- xwwwing.com Check certs : 2
Zoom Phishing Domains
- businessprozoom.com Check certs : 3
- cupzoom.com Check certs : 3
- digizoomonline.com Check certs : 2
- dreamlifezoom.com Check certs : 2
- lead-zoom.agency Check certs : 4
- lead-zoomteam.com Check certs : 4
- leadzoom-team.com Check certs : 4
- livezoomtv.xyz Check certs : 2
- locuszoom.com Check certs : 4
- mojoszoom.com Check certs : 3
- muslimzoom.com Check certs : 2
- painzoom.rest Check certs : 3
- smoothiezoom.com Check certs : 3
- team-leadzoom.com Check certs : 4
- webinarzoom.com Check certs : 1
- webzoomus.online Check certs : 2
- zoomaistas.info Check certs : 4
- zoomarketi.store Check certs : 3
- zoomconcept.com Check certs : 4
- zoomersvsboomers.com Check certs : 2
- zoomeventsdemo.xyz Check certs : 2
- zoomexpressdelivery.online Check certs : 3
- zoomhomeschool.com Check certs : 1
- zoomies.store Check certs : 4
- zoomimpactworldwide.com Check certs : 2
- zoomin.services Check certs : 2
- zoomindata.com Check certs : 2
- zoomjogger.online Check certs : 2
- zoomjogger.space Check certs : 2
- zoomlistingmanagement.com Check certs : 2
- zoomly.app Check certs : 3
- zoomout.blog Check certs : 4
- zoompanelist.com Check certs : 3
- zoomrocks.com Check certs : 2
- zoomset.com Check certs : 2
Ryuk Phishing Domains
- adsspsupport.shop Check certs : 1
- aib-mobile-support-team.com Check certs : 6
- aidesupport.services Check certs : 3
- allsaintsupport.com Check certs : 3
- anzsecure-support.com Check certs : 5
- aolemailsupport.xyz Check certs : 2
- applefmi-support.live Check certs : 3
- backupamazon.com Check certs : 4
- backupinsta.com Check certs : 2
- baskintechsupport.com Check certs : 3
- bitcoinsupport.email Check certs : 3
- blockchainsupportt.com Check certs : 3
- blogkitssupport.com Check certs : 2
- boasupportteam.com Check certs : 1
- boi-support-service.com Check certs : 1
- bookingsupport.online Check certs : 1
- bspnne-supports.xyz Check certs : 4
- bsrealestatesupport.online Check certs : 1
- callagentsupport.monster Check certs : 3
- callagentsupporta.monster Check certs : 2
- callagentsupportd.monster Check certs : 3
- callagentsupportf.monster Check certs : 3
- callagentsupportg.monster Check certs : 3
- callagentsupporth.monster Check certs : 3
- callagentsupportj.monster Check certs : 6
- callagentsupportk.monster Check certs : 3
- callagentsupportl.monster Check certs : 6
- callagentsupports.monster Check certs : 6
- ccstechsupport.com Check certs : 2
- cexosupport.info Check certs : 4
- cfylivesupport.com Check certs : 3
- childsupport.exchange Check certs : 2
- childsupportt.exchange Check certs : 2
- clarencevalleysupports.com Check certs : 2
- clothessupport.com Check certs : 3
- cloudsupportadmincenter.com Check certs : 3
- confiidentialsupport.com Check certs : 3
- dhiorf-supports.wiki Check certs : 3
- edustudysupport.com Check certs : 3
- ehqusz-supports.today Check certs : 3
- emailinfo-support.com Check certs : 2
- epa-flight-backup.com Check certs : 2
- eventsupport.xyz Check certs : 3
- evofficesupport.com Check certs : 3
- findsupport-id.com Check certs : 3
- fiona-relief-support.com Check certs : 2
- for-backup.com Check certs : 2
- gcfsupport.com Check certs : 2
- gcfsupport.org Check certs : 2
- gcsupport.org Check certs : 2
- griffincaressupport.com Check certs : 2
- griffincaressupport.org Check certs : 2
- gtizue-supports.cyou Check certs : 3
- hal-homesupport.com Check certs : 3
- helpsupports.info Check certs : 2
- hi1winonlinesupport.xyz Check certs : 5
- hi2winonlinesupport.xyz Check certs : 5
- hi3winonlinesupport.xyz Check certs : 5
- hi4winonlinesupport.xyz Check certs : 2
- higheronesupport.com Check certs : 3
- hkcancersupport.org Check certs : 3
- homesupporttwixt.xyz Check certs : 3
- hylcea-supports.sbs Check certs : 3
- ibmsupportinfo.com Check certs : 4
- icld-support.info Check certs : 4
- idsupport-find.com Check certs : 3
- infosupport-netflix.com Check certs : 2
- isupport.network Check certs : 3
- isupportpros.com Check certs : 3
- it-onlinesupport.com Check certs : 3
- it-support.best Check certs : 3
- itrgvsupport.com Check certs : 3
- itsupportcompaniesnearme.com Check certs : 1
- itsupportsusa.com Check certs : 2
- kansaiclean-support.com Check certs : 3
- kansaigarden-support.com Check certs : 3
- kendraailsupport.com Check certs : 2
- litigationsupportca.com Check certs : 1
- mailsupport.world Check certs : 2
- meetingyourneedssupportservices.com Check certs : 2
- mksecretarysupport.shop Check certs : 1
- moriokass-support.com Check certs : 3
- my3-supportbill.com Check certs : 5
- myee-bill-support.com Check certs : 1
- naturesupport-jp.com Check certs : 3
- netflix-support-online.com Check certs : 2
- netflixingsupport.online Check certs : 2
- netsupportcommunityit.com Check certs : 2
- neweverydaydietsupport.com Check certs : 3
- officesupports.com Check certs : 1
- online-pakage-support.info Check certs : 3
- onlinesupportmodule.online Check certs : 1
- phlycommunitysupport.com Check certs : 2
- planbuddysupportscoordination.org Check certs : 2
- powellsupportiveservices.com Check certs : 4
- priority-support.online Check certs : 2
- prosupport.expert Check certs : 2
- prosupport.pro Check certs : 2
- psychedelicsupportservices.com Check certs : 2
- rainyysupport.com Check certs : 3
- rbfcusupporthelpdesk.com Check certs : 5
- reality-support.org Check certs : 2
- remindernetflix1support.com Check certs : 2
- revolut-identity-support.com Check certs : 1
- sagesupportnumber.com Check certs : 2
- sanjosupportservice.com Check certs : 4
- secureapisupport.live Check certs : 2
- senkyosupport.com Check certs : 3
- shopifysupport.com Check certs : 1
- silkroadmedsupport.com Check certs : 1
- smaartchildsupport.com Check certs : 2
- smarrtchildsupport.com Check certs : 2
- smartcchildsupport.com Check certs : 2
- smartchildsupports.com Check certs : 2
- smatrchildsupport.com Check certs : 2
- smrsupportservices.com Check certs : 2
- southernmagnoliabirthsupport.com Check certs : 3
- stagerightsupporters.com Check certs : 3
- startupsupportshareworks.com Check certs : 2
- statsupportusa.com Check certs : 3
- stressfreetechsupport.com Check certs : 2
- support-access-attempt.info Check certs : 6
- support-alkiop.com Check certs : 1
- support-alyiop.com Check certs : 1
- support-exodus.com Check certs : 1
- support-found.cloud Check certs : 5
- support-iphone.today Check certs : 3
- support-karina.com Check certs : 1
- support-masudaauto.com Check certs : 4
- support-pals.com Check certs : 2
- support-procoinbase.com Check certs : 3
- support-qoo10sg.com Check certs : 3
- support-rocke.com Check certs : 1
- support-xfinityconnect.com Check certs : 3
- support.wiki Check certs : 3
- support5b.com Check certs : 1
- support746165.asia Check certs : 5
- support746165.click Check certs : 6
- supportallmine.com Check certs : 2
- supportatspybriefing.com Check certs : 2
- supportbillingmarketplace.com Check certs : 8
- supportblackbanks.org Check certs : 2
- supportcheck.info Check certs : 3
- supportericchurch.com Check certs : 2
- supportexpressbillpay.com Check certs : 2
- supportfrace171022.asia Check certs : 5
- supportfrace171022.click Check certs : 6
- supportfromthetrenches.com Check certs : 3
- supporthr.info Check certs : 2
- supporthu891511.online Check certs : 1
- supporthu891511.site Check certs : 1
- supporthu891511.space Check certs : 1
- supporthu891511.website Check certs : 4
- supportimage-line.com Check certs : 3
- supportingmyasb.com Check certs : 6
- supportingmybnz.com Check certs : 2
- supportinlaterlife.org Check certs : 2
- supportkingsessays.com Check certs : 2
- supportkingsisle.com Check certs : 2
- supportkingsloot.com Check certs : 2
- supportmicrsoft.com Check certs : 2
- supportpepperstone.com Check certs : 2
- supportportal360.com Check certs : 2
- supportrealyoga.org Check certs : 2
- supports-net.com Check certs : 2
- supports-online.com Check certs : 5
- supportscammer.live Check certs : 3
- supportshare.net Check certs : 3
- supportssystem.com Check certs : 4
- supportstitt.com Check certs : 2
- supportteam86474564.asia Check certs : 5
- supportteam86474564.click Check certs : 6
- supportteam86474564.site Check certs : 4
- supportteam86474564.space Check certs : 4
- supportukraine.agency Check certs : 2
- supportvnora.info Check certs : 4
- svcsupports.com Check certs : 3
- tclsupport.biz Check certs : 2
- tdaccount-support.info Check certs : 10
- terra-support.help Check certs : 3
- textsupport.info Check certs : 7
- thegalaxysupport.com Check certs : 2
- theparentsupportnetwork.com Check certs : 1
- thetradersupport.com Check certs : 3
- togfbackup.com Check certs : 2
- topsmmsupport.com Check certs : 5
- unifiedsupport365.com Check certs : 2
- unifysupport365.com Check certs : 2
- uplink-in-gov-support.com Check certs : 3
- visasupportcardalerts.com Check certs : 1
- vnsupportfx.com Check certs : 3
- websupportalliedbenefit.com Check certs : 2
- wfhomepreservationsupportwellsfargo.com Check certs : 2
- wikipediasupport.org Check certs : 3
- wirelesslogicsupport-zendesk.com Check certs : 2
- wittyo-supports.site Check certs : 3
- wordpressonlinesupport.com Check certs : 2
- xpckci-supports.xyz Check certs : 4
- xywftc-supports.icu Check certs : 3
- xzysupport.com Check certs : 3
- yeswesupport.net Check certs : 2
- yourerpsupport.com Check certs : 1
- yoursupport.help Check certs : 3
Onlyfans Phishing Domains
- daryaonlyfans.com Check certs : 2
- gabisonlyfans.com Check certs : 2
- hannahbalmeratonlyfans.com Check certs : 2
- jakeonlyfans.com Check certs : 1
- lagence-onlyfans.com Check certs : 3
- onlyfans-advertising.online Check certs : 2
- onlyfans-casting.com Check certs : 1
- onlyfanslibrary.com Check certs : 2
- onlyfansplus.net Check certs : 2
- ruqisonlyfans.com Check certs : 2
- shariqsonlyfans.com Check certs : 2
- theonlyfans.online Check certs : 1
- zincaryonlyfans.com Check certs : 2