Potential Phishing domains for 2023-02-12
Feb 13, 2023
Phishing
The following newly registered domains were flagged as potential candidates for phishing campaign hosting
- Copyright (c) 2021 JamesBrine
- Permission is hereby granted, free of charge, to any person obtaining a copy of this list to deal in the list without restriction, including without limtiation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the list, and to permit persons to whom the list is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies or substantial portions of the list.
- THE LIST IS PROVIDED ‘AS IS’, WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE LIST OR THE USE OR OTHER DEALINGS IN THE LIST.
NOTICE FOR REMOVAL
- This page is created automaticaly given several factors, textual similarity to known brands/companies, SSL certificate data and provider, open ports, domain registrar and registrant info, on-page content, correlation against prior confirmed phishing campaigns, and so forth. An effort has been made to reduce false positives by appending a score (0-10) using AI/ML modelling. If you believe that your website has been placed on this page by error, please contact me by email with the link above to be considered for removal.
Overview of Phishing Domains by Category
Scores are given from 0-10 using AI/ML, with higher numbers being more likely phishing domains. Domains that are undetermined may be reviewed later.
Facebook Phishing Domains
- 123facebookads.com Check certs : 2
- chatfacebook.com Check certs : 2
- conc-facebook.com Check certs : 3
- facebook-223-impinch.shop Check certs : 2
- facebook-hosting.com Check certs : 2
- facebook-times.com Check certs : 3
- facebookgrantscompensation.com Check certs : 3
- nn-no-facebook.com Check certs : 4
Instagram Phishing Domains
- gorgstagram.com Check certs : 2
- instagramverifybluebadge.com Check certs : 6
- instagramverifybluebadge.online Check certs : 6
- instagramverifybluebadge.xyz Check certs : 7
Twitter Phishing Domains
- istwittergone.com Check certs : 3
- mail-twitter.com Check certs : 3
- malice4twitter.com Check certs : 2
- testtwitterclone2.com Check certs : 2
- twitter-sea.com Check certs : 1
- viptwitter.com Check certs : 2
Virus Phishing Domains
- malwarebytes-premium.org Check certs : 3
- malwarebytespremium.com Check certs : 2
Support Phishing Domains
- anewdesigninc.com Check certs : 2
- brasilfinansuport.com Check certs : 2
- buscar-suporte-local.online Check certs : 2
- devsuporteoberon.tech Check certs : 3
- down4designinteriors.com Check certs : 3
- mtbsuportz7354.com Check certs : 3
- paulaoliversuporte.online Check certs : 2
- prevencaosuporte.shop Check certs : 2
- psuporte.xyz Check certs : 6
- ravdesigninc.com Check certs : 3
- sign-in-scotiabank.com Check certs : 6
- signin-o365.cloud Check certs : 2
- signinofficemicrosoftaccountnow.info Check certs : 8
- signintoaccountofficemicrosoft.top Check certs : 8
- suportefinalizar.info Check certs : 4
- suportsalertszellelle.com Check certs : 2
- suppportpdfiller.com Check certs : 3
- wjwsignin.com Check certs : 3
Login-Portal Phishing Domains
- 1001claimfunds-login-cadweb.com Check certs : 6
- accountlogin.online Check certs : 6
- accountmailrulogin3324820100000.ru Check certs : 7
- accountmailrulogin3324820100000.site Check certs : 7
- afcu-login.info Check certs : 8
- aibservicelogin.com Check certs : 6
- allfrontlogin.llc Check certs : 8
- anz-digital-login.com Check certs : 6
- bilbao-login.digital Check certs : 7
- bitstamplogin-home.xyz Check certs : 7
- bltstamp-logln.xyz Check certs : 2
- caostcaptal-login.com Check certs : 6
- centeirmylogin.net Check certs : 7
- client-login-fx.life Check certs : 7
- client-login-fx.shop Check certs : 6
- client-login-fx.xyz Check certs : 7
- clientloginfxpro.online Check certs : 6
- converges-login.com Check certs : 6
- dkb-login.biz Check certs : 7
- fairbaazilogin.com Check certs : 7
- fastpasslogin.com Check certs : 7
- fastsecurelogin.com Check certs : 7
- george-login.buzz Check certs : 7
- hamlogin.asia Check certs : 7
- iamlogin.ru Check certs : 7
- lastlogin.club Check certs : 7
- lastlogin.info Check certs : 8
- lastlogin.live Check certs : 7
- login-manageservices.com Check certs : 7
- login-to-icloud.com Check certs : 7
- login2-coinbase.com Check certs : 8
- login2-managerservice.com Check certs : 7
- login2-manageupdate.com Check certs : 7
- login2-reconfirmupdate.com Check certs : 7
- login2-secureupdate.com Check certs : 7
- login2-serviceaccounts.com Check certs : 7
- login2-servicewithdrawal.com Check certs : 7
- login2-updateaccount.com Check certs : 7
- login2-withdrawalcoinbase.com Check certs : 7
- loginend.com Check certs : 8
- loginlegderwebapp.net Check certs : 7
- loginreviewato.info Check certs : 8
- logins-blockchain.com Check certs : 8
- loginvent.com Check certs : 6
- mygov-login.info Check certs : 8
- naga4dlogin.com Check certs : 7
- newloginbetuss.xyz Check certs : 8
- onlineledgerlogin.com Check certs : 7
- pennfosterlogin.info Check certs : 10
- review-newlogin.com Check certs : 6
- rokulogin.com Check certs : 7
- sdo-logln.com Check certs : 2
- secure2-loginaccount.com Check certs : 7
- secureledgerlogin.net Check certs : 7
- thelastlogin.com Check certs : 7
- tvbloginfo.com Check certs : 8
- uspostk-login.buzz Check certs : 6
- vaglogins.co.uk Check certs : 7
- validatebayerhfculogin.com Check certs : 8
- wolf777login.com Check certs : 7
Office365 Phishing Domains
- install-office365.com Check certs : 1
- micro-office365.com Check certs : 1
- office365-install.com Check certs : 1
- office365-setup.com Check certs : 6
- reply-to-microsoftmail-office365.com Check certs : 3
Microsoft Phishing Domains
- japanmicrosoft.online Check certs : 1
- microsoft-active.directory Check certs : 2
- microsoft-ai.net Check certs : 2
- microsoft365emailessentials.net Check certs : 2
- microsoftbingchat.com Check certs : 2
- microsoftcarbon.com Check certs : 2
- microsoftexxchang3e4e6ee46f737e98e2e08e2e.com Check certs : 3
- microsoftlivecloudonlineupdate.live Check certs : 3
- microsoftsolutioncloudliveonline.live Check certs : 3
- microsoftterms.com Check certs : 2
- reply-to-microsoftmail-office365.com Check certs : 3
- signinofficemicrosoftaccountnow.info Check certs : 8
- signintoaccountofficemicrosoft.top Check certs : 8
- surface-microsoftstore.com Check certs : 1
Linkedin Phishing Domains
- cursodelinkedin.com Check certs : 4
- linkedin.loan Check certs : 2
- linkedin4biz.com Check certs : 2
- linkedininmail.com Check certs : 3
- linkedinsummarygenerator.com Check certs : 2
Dropbox Phishing Domains
- dropboxreview.com Check certs : 1
Adobe Phishing Domains
- adobe-expertises.net Check certs : 3
- adobeapp.online Check certs : 3
- adobeapp.store Check certs : 3
- adobeshed.com Check certs : 2
- adobesheds.com Check certs : 2
- adobewtf.com Check certs : 2
- creativecloud.top Check certs : 3
- juliannamachadobeauty.com Check certs : 3
Paypal Phishing Domains
- hotpayplus.shop Check certs : 1
- n0wpayplus.beauty Check certs : 2
- paypalcreditli.com Check certs : 3
- paypalegypt.com Check certs : 3
- payplexsolutions.com Check certs : 5
- virtualpaypalaccount.com Check certs : 8
- xpayplus.beauty Check certs : 2
Amazon Phishing Domains
- 827hbs2amazon.com Check certs : 1
- amazon-a.com Check certs : 1
- amazon-aws.live Check certs : 2
- amazon-lost.online Check certs : 1
- amazon-online.store Check certs : 2
- amazon-rewards-hub.info Check certs : 3
- amazon066.com Check certs : 3
- amazon68vn.com Check certs : 3
- amazon7s.com Check certs : 3
- amazonalerenewal.com Check certs : 1
- amazonbasicsdesign.com Check certs : 2
- amazoncaredesign.com Check certs : 2
- amazoncarforsale.com Check certs : 2
- amazoncashlab.com Check certs : 2
- amazoncontractorsinc.com Check certs : 1
- amazoncore10.com Check certs : 2
- amazoncreativewriting.com Check certs : 2
- amazoncryptominers.com Check certs : 5
- amazondashdesign.com Check certs : 2
- amazondashreplenishment.com Check certs : 2
- amazondirectpallet.com Check certs : 2
- amazonecojp.pics Check certs : 2
- amazoneexperts.com Check certs : 1
- amazonfashion.space Check certs : 1
- amazonfulfilled.com Check certs : 2
- amazonglobaldesign.com Check certs : 2
- amazongodesign.com Check certs : 2
- amazongoodthreads.com Check certs : 2
- amazonhublocker.com Check certs : 2
- amazonhyperzon.com Check certs : 2
- amazonianshoes.org Check certs : 2
- amazonjpjp.top Check certs : 3
- amazonmessagingframework.net Check certs : 2
- amazonmobilemasters.com Check certs : 2
- amazonn-jp.xyz Check certs : 3
- amazonnoaccounthold.com Check certs : 6
- amazono-co-jp.top Check certs : 3
- amazonoccupationaltherapy.com Check certs : 2
- amazonordet.com Check certs : 1
- amazonpaying.com Check certs : 2
- amazonprime-myaccount.com Check certs : 6
- amazonprimebookbox.com Check certs : 2
- amazonprimefirestick.com Check certs : 1
- amazonpv.com Check certs : 2
- amazons.tech Check certs : 0
- amazonservicesjapan.com Check certs : 2
- amazonservicess.com Check certs : 1
- amazonsparkdesign.com Check certs : 2
- amazonspreeshopping.com Check certs : 2
- amazonunboxdesign.com Check certs : 2
- amazonwildgame.com Check certs : 2
- amazonwithhyperzon.com Check certs : 2
- amazonyourgarage.com Check certs : 2
- amezon.work Check certs : 2
- awhaz8lxmns4amazon.com Check certs : 1
- azurestamazonndard.com Check certs : 3
- bannedbyamazon.store Check certs : 3
- cashamazonlab.com Check certs : 2
- futureamazon.fund Check certs : 3
- getstartedonamazon.co.uk Check certs : 1
- guardianoftheamazon.org Check certs : 3
- hj12n4amazon.com Check certs : 1
- hukhukamazon.com Check certs : 1
- hyperzonamazon.com Check certs : 2
- kyc-process-amazon.com Check certs : 3
- latinosamazon.com Check certs : 2
- mamazon.site Check certs : 2
- mentikoamazon.com Check certs : 1
- my-amazonaws.com Check certs : 3
- nanshapoo7625amazon.com Check certs : 3
- nuniksp7829amazon.com Check certs : 1
- polaz7axbah9amazon.com Check certs : 1
- productoslatinosamazon.com Check certs : 2
- promoteamazon.com Check certs : 1
- rayamezon.com Check certs : 2
- redirection-amazon.com Check certs : 2
- renamazon.com Check certs : 3
- secarek1amazon.com Check certs : 1
- shopamazonitalia.com Check certs : 1
- vendingamazon.cloud Check certs : 1
- wapzlmz-amazon.com Check certs : 1
Google Phishing Domains
- adlessgoogle.com Check certs : 2
- best-prompt-google-bard.com Check certs : 3
- economicimpact.google Check certs : 2
- googiemaps.com Check certs : 2
- google-adds.top Check certs : 5
- google-safe-mail.com Check certs : 3
- google9to5.com Check certs : 2
- googlebardprompts.com Check certs : 2
- googlebusinessprofileadvisor.com Check certs : 1
- googlebusinessprofileadvisors.com Check certs : 1
- googleclone.blog Check certs : 1
- googledeviceloaner.com Check certs : 2
- googledooble.com Check certs : 3
- googledoogle.com Check certs : 3
- googledubai.com Check certs : 2
- googlegu.com Check certs : 2
- googlehacking.com Check certs : 2
- googlehrb.com Check certs : 2
- googlelambda.com Check certs : 3
- googlenews.video Check certs : 2
- googlenov.com Check certs : 2
- googleoutdoor.com Check certs : 2
- googlesatellites.com Check certs : 2
- googlesbd.com Check certs : 3
- googlesecuirty.com Check certs : 2
- googlesparrow.co.uk Check certs : 1
- googleverification.info Check certs : 8
- howtocreatejapangoogleaccount.com Check certs : 8
- httprecoveraccountgoogle.com Check certs : 8
- httpswwwgoogletagmanagercomg.blog Check certs : 1
- isgoogleaiavailable.com Check certs : 2
- lambdagoogle.com Check certs : 2
- myclgoogle.store Check certs : 2
- passwordsleakcheck-pangoogleapis.com Check certs : 1
- removebadgoglereviews.com Check certs : 3
- texttospeechgoogle.com Check certs : 2
- tvgoogle.com Check certs : 2
- usgooglea.com Check certs : 3
Banks Phishing Domains
- bendigo-security3.com Check certs : 1
- bendigobank-o1.com Check certs : 2
- chathsbc.com Check certs : 1
- digitalcommbank.com Check certs : 2
- hsbc-plc.net Check certs : 2
- hsbc.fun Check certs : 1
- mail-hsbc.com Check certs : 3
- thebmhsbc.com Check certs : 1
- thehsbconline.com Check certs : 2
- unicredit-uk.com Check certs : 2
- wellsfargo-verify.info Check certs : 8
- westpac-au-pay.com Check certs : 3
- ylckhsbc.com Check certs : 2
Games Phishing Domains
- boroncsgo.uk Check certs : 2
- csgobarons.co.uk Check certs : 2
- csgobarons.uk Check certs : 2
- csgogiveaway.site Check certs : 2
- csgogoat.com Check certs : 3
- csgokeydrop.ru Check certs : 2
- csgos.site Check certs : 2
- downloadminecraftmods.com Check certs : 4
- fortnitefreeaccounts.com Check certs : 8
- free-fortniteskins.com Check certs : 3
- heartsofminecraft.online Check certs : 3
- marketplaces-csgo.com Check certs : 2
- minecraft-modes.ru Check certs : 3
- minecrafters.cool Check certs : 3
- minecraftor.com Check certs : 2
- minecraftrain.com Check certs : 2
- mostwantedfortnite.com Check certs : 3
- ofertasxbox.com Check certs : 3
- promocode-mycsgo.ru Check certs : 3
- vseemaxbox.com Check certs : 2
- vxcsgo.shop Check certs : 1
- warcraft.live Check certs : 2
- xboxversions.com Check certs : 2
Crypto Phishing Domains
- account-binance.ru Check certs : 7
- acoinbase.link Check certs : 1
- af-coinbase.com Check certs : 2
- ag-coinbase.com Check certs : 2
- ah-coinbase.com Check certs : 1
- ai-coinbase.com Check certs : 3
- aj-coinbase.com Check certs : 2
- authorization-coinbase.com Check certs : 2
- bcoinbase.link Check certs : 1
- binance-email.org Check certs : 1
- binance-helpdesk.com Check certs : 3
- binance888.xyz Check certs : 2
- binancebit.com Check certs : 3
- binanceyenietkinliklervekampanyalardanhaberdarol.net Check certs : 2
- ccoinbase.link Check certs : 1
- coinbase-tradepromax.com Check certs : 2
- coinbases.info Check certs : 4
- config-coinbase.com Check certs : 4
- financial-coinbase.com Check certs : 2
- fuckcoinbase.com Check certs : 1
- login2-coinbase.com Check certs : 8
- login2-withdrawalcoinbase.com Check certs : 7
- slotpgwalllet.com Check certs : 2
- solidcoinbase.info Check certs : 4
- temp-coinbase.com Check certs : 2
- transactionstatement-coinbase.com Check certs : 2
- vps-coinbase.com Check certs : 4
- walletcoinbase.trade Check certs : 3
- withdrawalapproval-coinbase.com Check certs : 2
- withdrawalapprove-coinbase.com Check certs : 2
Alibaba Phishing Domains
- aialibaba.vip Check certs : 1
- alibaba-ai.net Check certs : 2
- alibaba138slot.com Check certs : 3
- alibabacloud-dns-lsyhjf01.com Check certs : 2
- alibabacloud-dns-lsyhjf02.com Check certs : 2
- alibabacloud-dns-lsyhjf03.com Check certs : 2
- alibabacloud-dns-lsyhjf05.com Check certs : 2
- alibabacloudturkiye.com Check certs : 1
- alibabapodcast.org Check certs : 2
- alibabashop-th.com Check certs : 2
www Phishing Domains
- fwww05e2k9l0.xyz Check certs : 2
- httpswwwgoogletagmanagercomg.blog Check certs : 1
- sonofit-www.com Check certs : 2
- thewwwname.com Check certs : 2
- thwww.cfd Check certs : 2
- twww.shop Check certs : 1
- urgentks3m-tbnkwww.live Check certs : 2
- www—7766.com Check certs : 2
- www-3678.com Check certs : 2
- www-apple-apple-inc.com Check certs : 2
- www-appleld-apple-us.com Check certs : 2
- www-appleld-apple.com Check certs : 2
- www-apponline.com Check certs : 1
- www-authentification-bmo-account.xyz Check certs : 8
- www-bitskins.ink Check certs : 1
- www-bmo-myaccount-online.xyz Check certs : 8
- www-bsdh12.vip Check certs : 2
- www-bsdh13.vip Check certs : 2
- www-bsdh14.vip Check certs : 2
- www-bsdh15.vip Check certs : 2
- www-bsdh16.vip Check certs : 2
- www-bsdh17.vip Check certs : 2
- www-bsdh18.vip Check certs : 2
- www-bsdh19.vip Check certs : 2
- www-bsdh20.vip Check certs : 3
- www-cai888.com Check certs : 2
- www-coiinex.net Check certs : 2
- www-dmarket.ink Check certs : 2
- www-hg19.com Check certs : 2
- www-icloud-locateds.info Check certs : 4
- www-lookrare.ink Check certs : 2
- www-looksrare.ink Check certs : 2
- www-sme-usa.com Check certs : 3
- www-teriberka-sea.ru Check certs : 1
- www10.link Check certs : 1
- www12-bmo-online-myccount.xyz Check certs : 3
- www1instacart.com Check certs : 2
- www236565.com Check certs : 2
- www267779.com Check certs : 1
- www27461.com Check certs : 2
- www27491.com Check certs : 2
- www29266.net Check certs : 2
- www310303.com Check certs : 2
- www44302y.com Check certs : 2
- www444hgswwwhgswww.org Check certs : 2
- www45ky.com Check certs : 1
- www4hu37c.com Check certs : 1
- www4hu37p.com Check certs : 1
- www508686.com Check certs : 2
- www555272.com Check certs : 3
- www565668.com Check certs : 2
- www56marsbahis.com Check certs : 2
- www605makrobet.com Check certs : 2
- www61anb.top Check certs : 3
- www661255.com Check certs : 3
- www66anc.top Check certs : 3
- www6f01.com Check certs : 2
- www6f1991.com Check certs : 2
- www6f1992.com Check certs : 2
- www6f1993.com Check certs : 2
- www6f1994.com Check certs : 2
- www6f1995.com Check certs : 2
- www6f1996.com Check certs : 2
- www6f1998.com Check certs : 2
- www6f1999.com Check certs : 2
- www6fcp0101.com Check certs : 2
- www73781.com Check certs : 2
- www73782.com Check certs : 2
- www771.xyz Check certs : 3
- www797.top Check certs : 3
- www808063.com Check certs : 2
- www839696.com Check certs : 2
- www862020.com Check certs : 2
- www86bfh.com Check certs : 1
- www879990.com Check certs : 2
- www88.top Check certs : 3
- www8xajz.top Check certs : 3
- www91.top Check certs : 3
- www92.xyz Check certs : 3
- www93244.com Check certs : 2
- www946161.com Check certs : 2
- www965757.com Check certs : 2
- www968383.com Check certs : 2
- www991betsl0.com Check certs : 1
- www991betsl0.xyz Check certs : 2
- wwwafffsettlement.com Check certs : 2
- wwwatlasbet449.com Check certs : 1
- wwwatlasbet450.com Check certs : 2
- wwwbetmatik0277.com Check certs : 1
- wwwbingchat.com Check certs : 3
- wwwbreetheaffiliate.com Check certs : 1
- wwwbungieclassaction.com Check certs : 2
- wwwcai888.com Check certs : 2
- wwwceffu.com Check certs : 2
- wwwceltabet705.com Check certs : 2
- wwwces.tech Check certs : 3
- wwwcita.com Check certs : 2
- wwwclippingmagic.com Check certs : 3
- wwwcollective.com Check certs : 2
- wwwdarkcloud.com Check certs : 2
- wwwdiwansport.com Check certs : 3
- wwwdoctorofcredit.com Check certs : 1
- wwweest8.top Check certs : 3
- wwwembark.com Check certs : 2
- wwwenergiegreen.com Check certs : 3
- wwwfavet.com Check certs : 3
- wwwfetoo.com Check certs : 2
- wwwformationkatrinyana.ru Check certs : 3
- wwwfunwithvaleriekay.com Check certs : 3
- wwwgoldenbahis486.com Check certs : 2
- wwwgvrternnew.top Check certs : 3
- wwwharrisbrothers.com Check certs : 2
- wwwhgskgspttavmwww.org Check certs : 2
- wwwhgskgspttavmwww.xyz Check certs : 3
- wwwhiltonbet1031.com Check certs : 1
- wwwholiganbet787.com Check certs : 1
- wwwholiganbet787.xyz Check certs : 2
- wwwhostcn.com Check certs : 2
- wwwihb-cmactacna.com Check certs : 1
- wwwilder.agency Check certs : 3
- wwwilder.com Check certs : 3
- wwwinterbahis1255.com Check certs : 2
- wwwjlbet.com Check certs : 2
- wwwjs3039.com Check certs : 1
- wwwkanggu.com Check certs : 1
- wwwkk78.com Check certs : 2
- wwwkrafton.com Check certs : 2
- wwwm8qp.com Check certs : 1
- wwwnakitbahis678.com Check certs : 2
- wwwnevly.com Check certs : 2
- wwwngsbahis522.com Check certs : 2
- wwwnvcareercenter.org Check certs : 3
- wwwoi.top Check certs : 5
- wwwooo.online Check certs : 1
- wwwpacermonitor.com Check certs : 2
- wwwperabet910.com Check certs : 2
- wwwpersiennedesign.com Check certs : 2
- wwwprieuredesaintcyr.com Check certs : 3
- wwwptthgskgswww444.org Check certs : 2
- wwwrfi.com Check certs : 2
- wwws-latoken.com Check certs : 1
- wwwsafirbet910.com Check certs : 2
- wwwsamram.com Check certs : 4
- wwwsantiagoresidentpay.com Check certs : 2
- wwwsexu.com Check certs : 3
- wwwspj49.com Check certs : 1
- wwwsssd.com Check certs : 2
- wwwthebitz420.shop Check certs : 2
- wwwthemedicalrebel.com Check certs : 3
- wwwtoles.website Check certs : 1
- wwwusps.top Check certs : 3
- wwwwanbo.com Check certs : 2
- wwwwbbpe.org Check certs : 3
- wwwwells.com Check certs : 2
- wwwwkgshgswww444.org Check certs : 2
- wwwwwhw.com Check certs : 2
- wwwxj6037.com Check certs : 2
- wwwz7yh.com Check certs : 2
- xxwww.top Check certs : 3
Zoom Phishing Domains
- ablanczoom.com Check certs : 1
- allelectriczoom.com Check certs : 2
- bizteamzoom.com Check certs : 2
- chatgptzoom.com Check certs : 1
- disposalzoom.xyz Check certs : 4
- edzoom.tech Check certs : 2
- izoom.fun Check certs : 1
- joinspecialzoom.com Check certs : 2
- kidszoomedical.com Check certs : 2
- medicarewithzoom.com Check certs : 2
- meetingconfzoom.site Check certs : 2
- meetingconfzoom.space Check certs : 2
- melissezoom.com Check certs : 2
- primaryzoomcall.com Check certs : 2
- rezoomai.com Check certs : 2
- salonmentorszoom.com Check certs : 2
- saltzoom.live Check certs : 2
- strollbrzoom.com Check certs : 2
- strollbtrzoom.com Check certs : 2
- strollzoom.com Check certs : 2
- wearezooming.com Check certs : 2
- zoom-car.com Check certs : 2
- zoom-prosetup.com Check certs : 7
- zoom08.buzz Check certs : 1
- zoomaniamc.net Check certs : 2
- zoomapy.com Check certs : 2
- zoomarist.com Check certs : 3
- zoomdoctor.co.uk Check certs : 2
- zoomeetingx.site Check certs : 2
- zoomeetingx.space Check certs : 2
- zoomexpres.com Check certs : 4
- zoomexpressllc.com Check certs : 3
- zoomfings.com Check certs : 3
- zoomiebottle.co.uk Check certs : 3
- zoomiestrailmix.com Check certs : 2
- zoomingwithbrooke.com Check certs : 2
- zoomlion-omsk.ru Check certs : 1
- zoomlion-perm.ru Check certs : 1
- zoomlion-simferopol.ru Check certs : 1
- zoomlionuav.com Check certs : 1
- zoomm14.buzz Check certs : 1
- zoommeetvi.site Check certs : 2
- zoomn04.buzz Check certs : 1
- zoompafilmes.com Check certs : 2
- zoomratio.com Check certs : 3
- zoomzautocare.com Check certs : 3
- zoooms.net Check certs : 2
Ryuk Phishing Domains
- abbusinesssupport.com Check certs : 3
- addictionlifesupport.com Check certs : 2
- agbusinesssupport-contactcenter.link Check certs : 1
- aicustomersupports.com Check certs : 1
- airconditionerservicesupports.com Check certs : 2
- alpileansupport.com Check certs : 2
- amonesupport.com Check certs : 2
- anzonline-support.com Check certs : 1
- aozora-support.net Check certs : 4
- ar-findmy-support.cloud Check certs : 1
- arkchildcaresupport.com Check certs : 3
- arransupport.com Check certs : 1
- autotasksupport.com Check certs : 1
- backupheating.com Check certs : 3
- backupmeai.com Check certs : 3
- banksupport.site Check certs : 2
- bitdefenderantivirussupport.com Check certs : 2
- boa-support01.com Check certs : 2
- bodysupportpillow.co.uk Check certs : 4
- brenhamcancersupport.com Check certs : 3
- bridgeprosupport.com Check certs : 3
- brokerageiosupport.com Check certs : 1
- business-support-specialist.biz Check certs : 2
- business-support-specialist.com Check certs : 2
- business-support.best Check certs : 3
- businesssupportstudio.com Check certs : 1
- calmmeusasupport.com Check certs : 2
- carrotsupportrox.com Check certs : 1
- centiersupportq.info Check certs : 3
- click-to-support.net Check certs : 2
- cloudbackups.uk Check certs : 1
- clubsupport24x7.com Check certs : 1
- commtech-support.com Check certs : 1
- connecttosupport.uk Check certs : 2
- consumerclaimsupport.com Check certs : 2
- customersupport-desk.help Check certs : 2
- cyberassetsbackup.com Check certs : 3
- dbisupportprod.com Check certs : 1
- delivery-support-parcel.com Check certs : 2
- dhl-support.net Check certs : 2
- dibasupportdealpha.net Check certs : 2
- digitalsupportteams.com Check certs : 2
- e-supportgemini.com Check certs : 3
- elevatecrmsupport.com Check certs : 3
- energysupport.uk Check certs : 1
- energysupportscheme.co.uk Check certs : 1
- exhalesalonsupport.co.uk Check certs : 2
- factorysupport.net Check certs : 3
- finksmcsupport.com Check certs : 5
- flexsupportmotorolasolutions.com Check certs : 3
- fmcsaclearinghousesupport.com Check certs : 2
- gakusyusupport-utubo.com Check certs : 1
- get-support123.net Check certs : 2
- getpsasupport.com Check certs : 1
- getsupport-finmy.com Check certs : 3
- glucofreezesupport.online Check certs : 2
- gonairsupport.com Check certs : 3
- haisupport.life Check certs : 2
- halfpricetechsupport.com Check certs : 1
- halopsasupport.com Check certs : 1
- here2support.org.uk Check certs : 0
- id-support-lcloud.com Check certs : 2
- iforgot-support.com Check certs : 3
- iluxitsupport.co.uk Check certs : 1
- incsupportnet.com Check certs : 1
- iphonefound-support.team Check certs : 2
- isupport-colob.cloud Check certs : 2
- isupport-mx.cloud Check certs : 3
- it-support-online.com Check certs : 2
- kerassentialssupport.online Check certs : 2
- kubackup.com Check certs : 3
- kumamoto-sumai-support.com Check certs : 2
- kybubblesupport.com Check certs : 2
- ldssupport247.com Check certs : 3
- mcfrpeersupport.com Check certs : 3
- metateamsupport.com Check certs : 1
- militarygamblingsupport.com Check certs : 2
- mira-dev-backup.ru Check certs : 2
- mkbwebsitesupport.online Check certs : 2
- moodsupport.org Check certs : 2
- morelsupportclub.co.uk Check certs : 2
- mx-support.cloud Check certs : 3
- my-gov-support.com Check certs : 1
- mybrokersupport.com Check certs : 3
- myrenewmesupport.com Check certs : 2
- neighborhoodsupportcoach.com Check certs : 3
- netbank-support.com Check certs : 1
- nicusupportforparents.store Check certs : 1
- online-restriction-support.com Check certs : 1
- optimalcommunitysupportservices.com Check certs : 2
- pawprintproductsupport.com Check certs : 3
- pcsupport.life Check certs : 2
- postoffice-online-support.com Check certs : 2
- postoffice-support-online.com Check certs : 2
- proactivesupport.net Check certs : 3
- promtsupport.com Check certs : 1
- psasupport.com Check certs : 1
- qfsassetssecuritybackup.com Check certs : 4
- quietumplussupport.online Check certs : 2
- renewal-support.top Check certs : 3
- renocomputersupport.com Check certs : 2
- salvinssupport.com Check certs : 1
- saudisupports.com Check certs : 2
- securebankofamericasupport.com Check certs : 1
- securedatabackup.co.uk Check certs : 1
- securesupport.life Check certs : 2
- smartadsupport.online Check certs : 3
- smilesupport.work Check certs : 1
- startsupportservices.com Check certs : 2
- sterlingsupportedliving.com Check certs : 1
- stonebriarsupport.net Check certs : 2
- sudosupport.xyz Check certs : 2
- support-cv.com Check certs : 2
- support-gnome.com Check certs : 1
- support-java.online Check certs : 2
- support-leafmind.com Check certs : 4
- support-liive.net Check certs : 3
- support-locate.cloud Check certs : 2
- support-modern.com Check certs : 3
- support-mx.cloud Check certs : 2
- support-mypackage-dhl.com Check certs : 2
- support-nl.com Check certs : 2
- support-squad1.net Check certs : 2
- support-telephone-vio.com Check certs : 5
- support4turkeynow.asia Check certs : 2
- support4turkeynow.com Check certs : 4
- support4turkeynow.org Check certs : 3
- supportclient-netflix.com Check certs : 2
- supportforloss.com Check certs : 2
- supportfrontlinellc.com Check certs : 1
- supportgm.net Check certs : 1
- supportobpritalia.com Check certs : 2
- supportobpronline.com Check certs : 2
- supportofficerramos.com Check certs : 1
- supportouroutdoortrapper.com Check certs : 3
- supportpolicybazaar.com Check certs : 3
- supportprotectcare.co.uk Check certs : 2
- supportrev.com Check certs : 3
- supports-clients-netflix.com Check certs : 3
- supports0centier.info Check certs : 3
- supports8centier.info Check certs : 3
- supportsnh.info Check certs : 4
- supportsolv.com Check certs : 2
- supportsqcentier.info Check certs : 3
- supportsw.info Check certs : 4
- swiftiesupport.com Check certs : 2
- syncromspsupport.com Check certs : 1
- syncrosupport.com Check certs : 1
- taisyokusupport.net Check certs : 3
- techsupportforthesoul.com Check certs : 2
- techsupportnb.com Check certs : 3
- themorelsupportclub.co.uk Check certs : 2
- thissupport.co.uk Check certs : 1
- tollfree-supportnumber.com Check certs : 2
- usmvsupport.com Check certs : 3
- websitesupport.ru Check certs : 2
- xtechsupport.org Check certs : 2
- yoursunshinesupport.com Check certs : 3
- yoursupport321.net Check certs : 2
- yousupportedme.com Check certs : 2
- yousupportedme.org Check certs : 2
- youtheducationsupporters.com Check certs : 2