Potential Phishing domains for 2023-02-13
Share on:
Feb 14, 2023
Phishing
The following newly registered domains were flagged as potential candidates for phishing campaign hosting
- Copyright (c) 2021 JamesBrine
- Permission is hereby granted, free of charge, to any person obtaining a copy of this list to deal in the list without restriction, including without limtiation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the list, and to permit persons to whom the list is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies or substantial portions of the list.
- THE LIST IS PROVIDED ‘AS IS’, WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE LIST OR THE USE OR OTHER DEALINGS IN THE LIST.
NOTICE FOR REMOVAL
- This page is created automaticaly given several factors, textual similarity to known brands/companies, SSL certificate data and provider, open ports, domain registrar and registrant info, on-page content, correlation against prior confirmed phishing campaigns, and so forth. An effort has been made to reduce false positives by appending a score (0-10) using AI/ML modelling. If you believe that your website has been placed on this page by error, please contact me by email with the link above to be considered for removal.
Overview of Phishing Domains by Category
Scores are given from 0-10 using AI/ML, with higher numbers being more likely phishing domains. Domains that are undetermined may be reviewed later.
Facebook Phishing Domains
- churchfacebookads.com Check certs : 2
- facebook-15-conccellamentessence.com Check certs : 3
- facebookadsupport.com Check certs : 1
- facebookeu.com Check certs : 2
- facebooklockup.com Check certs : 3
- facebookusers0.com Check certs : 1
- homesforsalenearfacebookcampus.com Check certs : 2
- metafacebok.com Check certs : 2
- metasupporthelp.com Check certs : 1
- myfacebookpages.com Check certs : 1
- racebooktv.com Check certs : 2
Instagram Phishing Domains
- iinstagam.top Check certs : 3
- instagam.top Check certs : 3
- instagram-es.link Check certs : 1
- instagramclub.xyz Check certs : 3
- instagramdownloader.link Check certs : 1
- instagramviews.com Check certs : 5
- letrasinstagram.com Check certs : 2
- penstagram.tech Check certs : 1
- whydoinstagramaccountsnotdeletei.com Check certs : 8
Twitter Phishing Domains
- eutwitter.com Check certs : 2
- growtwitterfollowers.com Check certs : 2
- twitter24.com Check certs : 3
- twitteraraclari.com Check certs : 5
- twitterbase.com Check certs : 2
- twittercoins.info Check certs : 3
- twitterhelpright.com Check certs : 3
- twitterlockup.com Check certs : 3
- twitterprison.com Check certs : 3
- xn–twitterhesaplar-mlc.com Check certs : 3
Virus Phishing Domains
- adwcleaner-malwarebytes.cfd Check certs : 2
- adwcleaner-malwarebytes.click Check certs : 2
- adwcleaner-malwarebytes.foundation Check certs : 3
- malwarebytes-adwcleaner.cfd Check certs : 2
- malwarebytes-adwcleaner.click Check certs : 2
Support Phishing Domains
- 3ddesigninc.shop Check certs : 1
- acmsuportevirtual.com Check certs : 2
- classuport.cloud Check certs : 2
- creativesuport.org.uk Check certs : 1
- customdesigninteriors.online Check certs : 2
- customdesigninteriors.ru Check certs : 3
- customdesigninteriors.shop Check certs : 2
- customdesigninteriors.website Check certs : 2
- design-interpreted.com Check certs : 7
- goldendesigninteriors.com Check certs : 3
- hoteldesigninc.co.uk Check certs : 1
- m-mygov-signin.com Check certs : 1
- mtbsuportz7364.com Check certs : 3
- mygovsignin.com Check certs : 3
- nebdesigninteriors.com Check certs : 4
- passwordreset.site Check certs : 3
- sign-inwithethereum.com Check certs : 7
- signin-ausgovhelp.com Check certs : 1
- signin-mygovau-help.com Check certs : 1
- signin.amsterdam Check certs : 2
- support-signin-mygovau.com Check certs : 1
- wwwcustomdesigninteriors.ru Check certs : 3
- xn–suportelocaes-sgb4s.com Check certs : 3
Login-Portal Phishing Domains
- bancobrasil-login3.top Check certs : 8
- blaze-login.com Check certs : 8
- dolar88login.com Check certs : 8
- eki-login.club Check certs : 7
- eki-login.com Check certs : 6
- eki-login.top Check certs : 8
- embodylogin.com Check certs : 7
- fr-pnblogin.com Check certs : 7
- gcchublogin.com Check certs : 8
- glogin.online Check certs : 8
- gmailcomlogin.org Check certs : 7
- influencerlogin.com Check certs : 7
- influencerviplogin.com Check certs : 7
- lcloud-idpin-login.info Check certs : 9
- ledger-weblogin.net Check certs : 7
- ledger-webloginapp.net Check certs : 7
- login-blucite.net Check certs : 7
- login-mygovau-online.com Check certs : 6
- login-mygv.info Check certs : 8
- login-rbc.com Check certs : 6
- loginacct.com Check certs : 7
- logindigitalagency.com Check certs : 8
- loginliveledger.com Check certs : 7
- loginprofy.com Check certs : 9
- loginsecaccess.com Check certs : 6
- loglns-lnfo.com Check certs : 2
- manage-login-activity.com Check certs : 6
- mygovdatalogin.top Check certs : 8
- mygovlogin.info Check certs : 8
- myvcflogin.com Check certs : 7
- nextwavelogin.net Check certs : 8
- premiumlogins.com Check certs : 8
- qqdewalogin.com Check certs : 8
- securelogin-ee.com Check certs : 7
- task-wellslogin.top Check certs : 8
- vcflogin.com Check certs : 7
- verified-login.net Check certs : 7
- vwwloginsunicovirtual.com Check certs : 7
- wp1clicklogin.com Check certs : 8
- wwwloginunlco-viaweb.com Check certs : 8
Microsoft Phishing Domains
- 365microsoftonline.net Check certs : 2
- amzmicrosoftverif.com Check certs : 1
- homesforsalenearmicrosoft.com Check certs : 1
- microsoft23-webmails.com Check certs : 3
- microsoftcsc.top Check certs : 3
- milo-microsoft.com Check certs : 0
- server-smtp-onmicrosoft.com Check certs : 3
Linkedin Phishing Domains
- chatlinkedin.com Check certs : 3
- homesforsalenearlinkedin.com Check certs : 1
- notifications-linkedin.com Check certs : 3
- thelinkedinguide.uk Check certs : 1
- thelinkedinstrategist.business Check certs : 2
Adobe Phishing Domains
- adobeaangelsstaffing.com Check certs : 1
- californiadoberman.shop Check certs : 2
- homesforsalenearadobe.com Check certs : 2
Paypal Phishing Domains
- homesforsalenearpaypal.com Check certs : 1
- paypal-receptionvirement.com Check certs : 2
- paypalsupport.net Check certs : 2
- propayplub.beauty Check certs : 2
Amazon Phishing Domains
- 827hbs2amazon.com Check certs : 1
- amazon-aws.info Check certs : 3
- amazon-aws.mobi Check certs : 2
- amazon-belgique.com Check certs : 2
- amazon-goods-api.com Check certs : 1
- amazon-refund-package.com Check certs : 1
- amazon-valid.com Check certs : 1
- amazon12859.com Check certs : 2
- amazon1593.com Check certs : 2
- amazon2719.com Check certs : 2
- amazon56.net Check certs : 1
- amazonasgems.com Check certs : 4
- amazonauctions.online Check certs : 1
- amazonbags.info Check certs : 3
- amazonbox.info Check certs : 3
- amazoncashlab.com Check certs : 2
- amazondealsday.shop Check certs : 2
- amazonetyjp.top Check certs : 4
- amazonfashion.asia Check certs : 1
- amazonfashionstore.com Check certs : 2
- amazonfbaexpert.com Check certs : 2
- amazongarage.info Check certs : 3
- amazongarageinc.com Check certs : 2
- amazongaragesinc.com Check certs : 2
- amazongiftcard.online Check certs : 2
- amazonium.co.uk Check certs : 2
- amazonmallstore.store Check certs : 1
- amazonoccupationaltherapy.net Check certs : 2
- amazononthedaily.com Check certs : 2
- amazonpaying.com Check certs : 2
- amazonsellersupportteam.com Check certs : 3
- amazonsgarage.com Check certs : 2
- amazonshop.bond Check certs : 1
- amazonus.store Check certs : 1
- amazonusaps.top Check certs : 3
- awhaz8lxmns4amazon.com Check certs : 1
- bannedbyamazon.net Check certs : 3
- bestamazonfinds.net Check certs : 3
- cashamazonlab.com Check certs : 2
- digitalamazon.co.uk Check certs : 1
- hj12n4amazon.com Check certs : 1
- homesforsalenearamazon.com Check certs : 1
- hosth4polzm7amazon.com Check certs : 2
- los-amazon.org Check certs : 2
- malis19adf6amazon.com Check certs : 1
- mntyu1adg9amazon.com Check certs : 1
- mufamazone.tokyo Check certs : 2
- myamazongarage.com Check certs : 2
- myamazonpal.co.uk Check certs : 1
- myu1opapg9amazon.com Check certs : 1
- polaz7axbah9amazon.com Check certs : 1
- theamazongarage.com Check certs : 2
- theamazonmall.shop Check certs : 2
- theamazonmalls.com Check certs : 2
- theamazonmallstore.com Check certs : 2
- tresyqpgu1ad9amazon.com Check certs : 1
- uhazb8azlan2amazon.com Check certs : 2
- xboxgamezone.ru Check certs : 4
- yu1oa9gpk0amazon.com Check certs : 1
Google Phishing Domains
- admingoogle.online Check certs : 2
- getfoundongoogle.co.uk Check certs : 1
- goglesheets.com Check certs : 2
- google-keywordplanner.biz Check certs : 2
- google-lamda.com Check certs : 1
- google-pt.com Check certs : 1
- google999.top Check certs : 3
- googleaisupport.com Check certs : 2
- googlebard.xyz Check certs : 3
- googlebardonline.com Check certs : 2
- googlebbd.com Check certs : 4
- googlebusinessprofile.co.uk Check certs : 2
- googlebusinessprofileadvisor.com Check certs : 1
- googlebusinessprofileadvisors.com Check certs : 1
- googleclone.net Check certs : 3
- googlegpt.org Check certs : 2
- googlemultisearch.online Check certs : 2
- googlemultisearch.store Check certs : 2
- googlenewsfeed.com Check certs : 2
- googlenopt.com Check certs : 1
- googlesafari.com Check certs : 2
- googleshets.com Check certs : 2
- googleupdatetask.com Check certs : 2
- homesforsaleneargoogle.com Check certs : 2
- igooglebard.com Check certs : 2
- playgooglecarteiradetransito.com Check certs : 3
- playtogoogle.com Check certs : 1
- skipgoogle.com Check certs : 2
Banks Phishing Domains
- bendigo-review.info Check certs : 3
- bendigosupport-au.com Check certs : 1
- bk-bendigo.com Check certs : 1
- online-securewestpacib-auth-au.com Check certs : 1
- sec-auth-bendigo.com Check certs : 3
- thebmhsbc.com Check certs : 1
- westpac-nline.com Check certs : 2
Games Phishing Domains
- analyzercsgo.host Check certs : 2
- auxbox.site Check certs : 3
- blizzardhvac.com Check certs : 1
- csgo2win.com Check certs : 2
- csgo95.com Check certs : 2
- csgomo.com Check certs : 2
- csgop2p.org Check certs : 2
- csgopull.com Check certs : 3
- dminecraft.com Check certs : 1
- earthminecraft.online Check certs : 1
- epicgames.sale Check certs : 2
- epicgameschat.com Check certs : 2
- fortnitebot.co.uk Check certs : 1
- fortniteonline.uk Check certs : 1
- kkcsgo.fun Check certs : 1
- kkcsgo.vip Check certs : 2
- llamaschoolfortnite.com Check certs : 3
- maniloveminecraft.online Check certs : 1
- marketplaces-csgo.net Check certs : 2
- mimunditominecraft.online Check certs : 3
- minecraft-verse.com Check certs : 2
- minecraftbedrockmods.com Check certs : 3
- minecraftforever.shop Check certs : 2
- minecraftopedia.info Check certs : 3
- minecraftopedia.online Check certs : 2
- minecraftverse.live Check certs : 2
- minecraftverse.online Check certs : 1
- minecraftwarriders.net Check certs : 2
- phloxbox.com Check certs : 4
- tibiacompra.com Check certs : 3
- vgxboxdaily.com Check certs : 2
- worldofwarcraft.website Check certs : 2
- xboxfix.com Check certs : 2
- xboxgamezone.ru Check certs : 4
Crypto Phishing Domains
- accountbinancecampingkatilimsayfalari.net Check certs : 7
- accountbinancecampingkatilimsayfasi.net Check certs : 7
- ak-coinbase.com Check certs : 1
- al-coinbase.com Check certs : 1
- am-coinbase.com Check certs : 1
- an-coinbase.com Check certs : 2
- ba-coinbase.com Check certs : 1
- bb-coinbase.com Check certs : 1
- bc-coinbase.com Check certs : 1
- bd-coinbase.com Check certs : 1
- be-coinbase.com Check certs : 1
- bf-coinbase.com Check certs : 1
- binance-account-camp.net Check certs : 7
- binance-camping-account-kampanya.net Check certs : 7
- binance-crypto-nft.com Check certs : 3
- binance.house Check certs : 2
- binanceaifi.com Check certs : 1
- binanceairdrop.net Check certs : 2
- binanceetkinlikvekampanyalarinisorgulamasayfamiz.net Check certs : 2
- binanceeventlerimizvekampanyalarimizisorgula.net Check certs : 2
- binanceeventlerinisorgulamavekampanyalarakatilma.net Check certs : 2
- binanceeventveetkinliklerisorgulamasayfamiz.net Check certs : 2
- binancepay.agency Check certs : 3
- binanceyenietkinlikvekampanyalariduyurulari.net Check certs : 2
- binanceyenieventvekampanyalardanhaberaldinizmi.net Check certs : 2
- chatbinance.com Check certs : 2
- coinbase-validate.info Check certs : 3
- coinbasesupport.org Check certs : 3
- global-binance.com Check certs : 1
- globalsupportbittrex.com Check certs : 3
- miningpool-binance.com Check certs : 1
- ml-coinbase.xyz Check certs : 3
- mycoinbase.info Check certs : 4
- trbinancec.com Check certs : 2
- xn–subatay-binance-elc.net Check certs : 2
- xn–subataym-binance-gqc.net Check certs : 2
- xn–yen-binance-yl-7fckb.net Check certs : 2
Alibaba Phishing Domains
- 51alibaba.top Check certs : 3
- aialibaba.net Check certs : 1
- alibaba-shopth.com Check certs : 2
- alibaba-z.com Check certs : 3
- alibaba88.vip Check certs : 2
- alibabacloud-pt-zjcl01.com Check certs : 2
- alibabacloud-pt-zjcl02.com Check certs : 2
- alibabacloud-pt-zjcl03.com Check certs : 2
- alibabacloud-pt-zjcl04.com Check certs : 2
- alibabacloud-pt-zjcl05.com Check certs : 2
- alibabacloud-ptcxw01.com Check certs : 2
- alibabacloud-ptcxw02.com Check certs : 2
- alibabacloud-ptcxw03.com Check certs : 2
- alibabacloud-ptcxw04.com Check certs : 2
- alibabacloud-ptcxw05.com Check certs : 2
- alibabajob-th.com Check certs : 3
- alibabajobth.com Check certs : 3
- alibabashishkabobs.com Check certs : 2
- casalibaba.com Check certs : 3
- jalibaba.com Check certs : 2
www Phishing Domains
- 1-www-ledgrder.com Check certs : 3
- atlas-www.com Check certs : 4
- awakefile-audwww.top Check certs : 3
- growwwth.agency Check certs : 3
- gwa-www.com Check certs : 2
- hazhhhhdqqqqqqqqqqwwwwwweeeeee.buzz Check certs : 2
- hgspttavmwww.xyz Check certs : 3
- httpswwwabrahamthepharmacist.com Check certs : 2
- httpswwwthomasdelauercomlife-optimization-tactics.com Check certs : 2
- oxiaoswww.top Check certs : 3
- ppwwwxc.top Check certs : 3
- qqqqqqqqwwwwwwww.com Check certs : 2
- ru-www.site Check certs : 2
- seaviewwwnsi.buzz Check certs : 2
- thewwwwebsite.com Check certs : 2
- uuuwwwnjnjn36.click Check certs : 1
- www-00163.com Check certs : 2
- www-08449.com Check certs : 2
- www-331777.com Check certs : 2
- www-50531.info Check certs : 3
- www-79723.com Check certs : 2
- www-ai.com Check certs : 3
- www-akbnkiadehizmetini2023subat.com Check certs : 1
- www-chat-gpt.ru Check certs : 2
- www-noritz.com Check certs : 2
- www-novadax.net Check certs : 2
- www-offiice.com Check certs : 3
- www-ok2929.com Check certs : 2
- www-ok3737.com Check certs : 2
- www-qatarpost.online Check certs : 2
- www-ru.site Check certs : 2
- www-shopfiy.com Check certs : 5
- www-strahovka.ru Check certs : 2
- www00797k.com Check certs : 2
- www01200.com Check certs : 2
- www0414.com Check certs : 2
- www11049.com Check certs : 2
- www115036.com Check certs : 3
- www116122.com Check certs : 2
- www121811.com Check certs : 3
- www12649.com Check certs : 1
- www15488.com Check certs : 3
- www175su.xyz Check certs : 2
- www209345.com Check certs : 2
- www209555.com Check certs : 2
- www222bg.com Check certs : 2
- www231677.com Check certs : 3
- www235955.com Check certs : 3
- www255138.com Check certs : 2
- www260000.com Check certs : 2
- www270999.com Check certs : 2
- www28484.com Check certs : 1
- www28dy.com Check certs : 2
- www299322.com Check certs : 2
- www309696.com Check certs : 2
- www30jili.com Check certs : 2
- www319191.com Check certs : 2
- www33166.com Check certs : 1
- www342525.com Check certs : 2
- www351234.com Check certs : 2
- www35ty.vip Check certs : 2
- www382626.com Check certs : 2
- www3zhegnshu1-zhuanyong1-pujing1-xianlu1-2yue12-www59777.com Check certs : 3
- www3zhegnshu2-zhuanyong2-pujing2-xianlu2-2yue13-www59777.com Check certs : 3
- www3zhegnshu3-zhuanyong3-pujing3-xianlu3-2yue14-www59777.com Check certs : 3
- www3zhegnshu4-zhuanyong4-pujing4-xianlu4-2yue15-www59777.com Check certs : 3
- www3zhegnshu5-zhuanyong5-pujing5-xianlu5-2yue16-www59777.com Check certs : 3
- www40595.com Check certs : 2
- www4078.com Check certs : 2
- www42210.com Check certs : 2
- www42329.com Check certs : 2
- www425ff.com Check certs : 2
- www425hh.com Check certs : 2
- www425tt.com Check certs : 2
- www43307.com Check certs : 2
- www4388.vip Check certs : 2
- www443838.com Check certs : 2
- www444955.com Check certs : 1
- www444hgspttavm.net Check certs : 2
- www444hgspttavmwwww.net Check certs : 2
- www444hgspttwww.net Check certs : 2
- www45332.com Check certs : 2
- www455662.com Check certs : 2
- www469ttt.com Check certs : 2
- www469zzz.com Check certs : 2
- www47333.com Check certs : 2
- www506565.com Check certs : 2
- www507575.com Check certs : 2
- www508877.com Check certs : 2
- www50jili.com Check certs : 2
- www521b419.xyz Check certs : 2
- www52332.com Check certs : 2
- www534455.com Check certs : 2
- www541515.com Check certs : 2
- www542727.com Check certs : 2
- www5497.com Check certs : 2
- www555bg.com Check certs : 2
- www5599123.com Check certs : 2
- www58801.com Check certs : 2
- www596363.com Check certs : 2
- www5v5v.vip Check certs : 2
- www61224.com Check certs : 2
- www61691.vip Check certs : 2
- www61699.vip Check certs : 2
- www62548.vip Check certs : 2
- www630888.com Check certs : 2
- www644222.com Check certs : 2
- www656js.com Check certs : 2
- www659977.com Check certs : 3
- www669571.com Check certs : 2
- www66996.vip Check certs : 2
- www66jdd.com Check certs : 2
- www66jdd.vip Check certs : 2
- www6715.com Check certs : 2
- www6js.vip Check certs : 2
- www7139.com Check certs : 2
- www72672b.com Check certs : 2
- www72898.com Check certs : 2
- www74336.com Check certs : 2
- www749191.com Check certs : 2
- www75224.com Check certs : 2
- www753888.com Check certs : 2
- www77026.com Check certs : 2
- www78535.com Check certs : 2
- www7w.com Check certs : 1
- www801188.com Check certs : 2
- www804222.com Check certs : 2
- www812hx.top Check certs : 3
- www815555.com Check certs : 2
- www81ky.com Check certs : 2
- www823452.com Check certs : 2
- www83686.com Check certs : 2
- www856166.com Check certs : 2
- www856666.com Check certs : 2
- www86827.com Check certs : 2
- www880039.com Check certs : 2
- www899bb.com Check certs : 2
- www903333.com Check certs : 2
- www90jili.com Check certs : 2
- www91909.com Check certs : 2
- www91909.vip Check certs : 2
- www91ss70.xyz Check certs : 2
- www924443.com Check certs : 2
- www965454.com Check certs : 3
- www98528.com Check certs : 2
- www987234.com Check certs : 2
- www999405.com Check certs : 2
- www999bg.com Check certs : 2
- www99itv80.xyz Check certs : 2
- www9w9.vip Check certs : 2
- www9yy.vip Check certs : 2
- wwwakbnkiadehizmetini2023subat.com Check certs : 1
- wwwamg99.vip Check certs : 2
- wwwamxj5599.com Check certs : 1
- wwwarnivalcarrers.com Check certs : 3
- wwwbet365j.com Check certs : 2
- wwwbet365q.com Check certs : 2
- wwwbetano.org Check certs : 3
- wwwbetmarino620.com Check certs : 2
- wwwbetnano1406.direct Check certs : 2
- wwwbjddq.com Check certs : 1
- wwwcasibom240.com Check certs : 1
- wwwchunshuitang.xyz Check certs : 2
- wwwcitikk.top Check certs : 5
- wwwcustomdesigninteriors.ru Check certs : 3
- wwwdrsound.com Check certs : 3
- wwwdumanbet528.com Check certs : 2
- wwwfedex.net Check certs : 4
- wwwgeicosurvey.com Check certs : 2
- wwwgoodvillevehiclelosssettlement.com Check certs : 2
- wwwgt5577.com Check certs : 2
- wwwgt6611.com Check certs : 2
- wwwgt6644.com Check certs : 2
- wwwgt6699.com Check certs : 2
- wwwgt7722.com Check certs : 2
- wwwgt7744.com Check certs : 2
- wwwgt7766.com Check certs : 2
- wwwgt8877.com Check certs : 2
- wwwh9997.com Check certs : 2
- wwwha33888.com Check certs : 2
- wwwhenjuda.com Check certs : 4
- wwwhg222222.com Check certs : 2
- wwwhg33356.com Check certs : 2
- wwwhg555555.com Check certs : 2
- wwwhg888888.com Check certs : 2
- wwwhgspttavm.net Check certs : 2
- wwwhgswwwpttt444www.net Check certs : 2
- wwwhn861.com Check certs : 1
- wwwholiganbet874.com Check certs : 5
- wwwinkosfera.ru Check certs : 3
- wwwjd28.vip Check certs : 2
- wwwjipotv.xyz Check certs : 2
- wwwjs00028.com Check certs : 2
- wwwjs00035.com Check certs : 2
- wwwjs00068.com Check certs : 2
- wwwjs00096.com Check certs : 2
- wwwjs001.vip Check certs : 2
- wwwkavbet326.com Check certs : 2
- wwwke0005.com Check certs : 1
- wwwkj899.com Check certs : 3
- wwwkk78.net Check certs : 2
- wwwky08a.com Check certs : 2
- wwwky08s.com Check certs : 2
- wwwkzf.xyz Check certs : 2
- wwwlan955.com Check certs : 1
- wwwloginunlco-viaweb.com Check certs : 8
- wwwm3m3.com Check certs : 1
- wwwmacphioclassaction.com Check certs : 2
- wwwmagroclassaction.com Check certs : 2
- wwwmagrolimabclassaction.com Check certs : 2
- wwwnazamok23.ru Check certs : 3
- wwwncbankfeessettlement.com Check certs : 2
- wwwncc128.xyz Check certs : 2
- wwwonwin758.com Check certs : 1
- wwwonwin758.xyz Check certs : 2
- wwwosram.com Check certs : 1
- wwwphbet.bet Check certs : 2
- wwwpkcai.vip Check certs : 2
- wwwptp.com Check certs : 1
- wwwqq6610.com Check certs : 2
- wwwriteaidclassaction.com Check certs : 2
- wwwseguros.com Check certs : 2
- wwwslot.vip Check certs : 2
- wwwslots.video Check certs : 3
- wwwt3220.com Check certs : 1
- wwwtengxun.com Check certs : 2
- wwwtheanimalroadshow.com Check certs : 3
- wwwtk298.com Check certs : 2
- wwwts5088.com Check certs : 1
- wwwtu56.xyz Check certs : 2
- wwwunicefusa.org Check certs : 3
- wwwvv.vip Check certs : 2
- wwww6444hgspttavmwwww.net Check certs : 2
- wwwwhgspttwww.org Check certs : 2
- wwwwmfl.xyz Check certs : 2
- wwwx82123.com Check certs : 2
- wwwyf101.vip Check certs : 2
- wwwyf102.vip Check certs : 2
- wwwyf103.vip Check certs : 2
- wwwyf104.vip Check certs : 2
- wwwzeroblue.com Check certs : 2
- wwwzr1122.com Check certs : 2
- wwwzr6088.com Check certs : 2
- wwwzr88809.com Check certs : 2
Zoom Phishing Domains
- homesforsalenearzoomvideocommunications.com Check certs : 2
- ipzoomer.com Check certs : 3
- ipzoomr.com Check certs : 2
- megastarzoom.com Check certs : 2
- moneyzoom.co.uk Check certs : 2
- octozoom.com Check certs : 3
- us-zoom.net Check certs : 4
- z00mies.online Check certs : 3
- zoomagazinstav26.ru Check certs : 3
- zoomaudiovisual.net Check certs : 3
- zoomcargoexpress.com Check certs : 2
- zoomclap.com Check certs : 2
- zoomdaytradingclass.com Check certs : 2
- zoomdaytradingclasses.com Check certs : 2
- zoomdealz.net Check certs : 3
- zoomers.pics Check certs : 3
- zoompeak.net Check certs : 2
- zoomsavings.com Check certs : 3
- zoomsem.com Check certs : 2
- zoomsurveys.co.uk Check certs : 2
- zoomtoenglish.com Check certs : 2
- zoomwithoasis.com Check certs : 2
Ryuk Phishing Domains
- 365online-support.net Check certs : 3
- account-restriction-support.com Check certs : 6
- account-support-restriction.com Check certs : 6
- account-support-restrictions.com Check certs : 6
- afasupportedliving.com Check certs : 1
- alnsupportservice.co.uk Check certs : 1
- amazonsellersupportteam.com Check certs : 3
- appleld-support.info Check certs : 4
- assets-support.com Check certs : 3
- ato-tax-support.info Check certs : 3
- audiovisualsupport.co.uk Check certs : 1
- aussiewebsupport.biz Check certs : 3
- backuploli.online Check certs : 2
- bendigosupport-au.com Check certs : 1
- besupportive.co.uk Check certs : 1
- bmo-support.com Check certs : 1
- bridgewaysupport.co.uk Check certs : 2
- carefirstsupportliving.co.uk Check certs : 1
- cbcnetworksupport.org Check certs : 3
- centiersupport.info Check certs : 3
- centiersupportq.info Check certs : 3
- clouddesksupport.com Check certs : 2
- clouddesksupport.org Check certs : 1
- coinbasesupport.org Check certs : 3
- colormatrixregulatorysupporthub.com Check certs : 2
- consumercreditsupport.co.uk Check certs : 1
- customerrepairsupport.com Check certs : 2
- customersupportcrazycup.com Check certs : 4
- emailnotificationsupport.com Check certs : 3
- embusinesssupport.co.uk Check certs : 1
- energysupportadvisor.com Check certs : 3
- ercfinancialsupport.net Check certs : 3
- evasupport.org Check certs : 3
- everydaycommunicationsupport.net Check certs : 2
- facebookadsupport.com Check certs : 1
- febsupportadd.online Check certs : 2
- fundbackup.com Check certs : 3
- gateiosupport.site Check certs : 2
- globalsupportbittrex.com Check certs : 3
- googleaisupport.com Check certs : 2
- gwentcvsupport.co.uk Check certs : 1
- havanabackup.store Check certs : 2
- horizons-support.co.uk Check certs : 1
- integritysupport.net Check certs : 3
- internetsupportexperts.com Check certs : 3
- iservices-support-findmy.com Check certs : 2
- itsupportleeds.org.uk Check certs : 1
- k-support.net Check certs : 3
- kronossupport.uk Check certs : 1
- ksquaredsupport.com Check certs : 2
- ksupport.net Check certs : 3
- lvbusinesssupport.co.uk Check certs : 1
- medicalsupport.online Check certs : 2
- memz-support.com Check certs : 2
- metabusinessupport.com Check certs : 1
- metasupporthelp.com Check certs : 1
- minesupportservcies.com Check certs : 1
- moorditjsupports.net Check certs : 3
- my-gov-support.com Check certs : 1
- myrealtimesupport.com Check certs : 1
- nb-bizsupport.com Check certs : 3
- netflix-supportclient.com Check certs : 3
- nord-support.com Check certs : 3
- nurse-support.link Check certs : 2
- online-support-restrictions.com Check certs : 1
- online-wesupport.com Check certs : 3
- pangolinbackup.co.uk Check certs : 1
- partnesinsupport.org.uk Check certs : 1
- paypalsupport.net Check certs : 2
- pendulumsupportedliving.uk Check certs : 2
- psalmsupport.com Check certs : 3
- qsupportcentier.info Check certs : 3
- qsupportscentier1.info Check certs : 3
- quantumbackupledger.com Check certs : 3
- r-support.shop Check certs : 1
- remote-it-support.com Check certs : 3
- rgrssupportfunds.click Check certs : 2
- roseysupport.com Check certs : 2
- santisupportservices.online Check certs : 1
- savergatorsupport.com Check certs : 3
- stresslessofficesupport.co.uk Check certs : 1
- support-01techhelp.top Check certs : 3
- support-offices365.com Check certs : 3
- support-redirection.com Check certs : 3
- support-signin-mygovau.com Check certs : 1
- support23-365workflow.com Check certs : 3
- support247.network Check certs : 2
- supportchecks.online Check certs : 1
- supportdivineliving.com Check certs : 3
- supportersneaks.online Check certs : 1
- supporterssleeve.co.uk Check certs : 1
- supportinfousa.live Check certs : 4
- supportinternet4u.com Check certs : 3
- supportitalia.com Check certs : 3
- supportiveparents.uk Check certs : 1
- supportliving.co.uk Check certs : 2
- supportlocaldelivery.org Check certs : 2
- supportobpritalia.com Check certs : 2
- supportoutdoors.com Check certs : 3
- supportprogrammetesting.co.uk Check certs : 1
- supportraccondigi.com Check certs : 3
- supportreligiousfreedoms.com Check certs : 2
- supports0centier.info Check certs : 3
- supports8centier.info Check certs : 3
- supportscentier1.info Check certs : 3
- supportscheduledelivery-ups.com Check certs : 2
- supporttheworld.co.uk Check certs : 1
- supportturkeyrelief.com Check certs : 4
- t3supportsystem.com Check certs : 2
- techdensupport.com Check certs : 2
- technicalsupportoutsourcingphilippines.co.uk Check certs : 1
- technicalsupportphilippines.co.uk Check certs : 1
- technicalsupportservicesphilippines.co.uk Check certs : 1
- techsupportphilippines.co.uk Check certs : 1
- techsupportservicesphilippines.co.uk Check certs : 1
- tenderlovesupports.com Check certs : 2
- the-support-squad.com Check certs : 2
- theobidientmovementsupportorganisation.com Check certs : 4
- thoughtsupport.shop Check certs : 0
- tokyoitsupport.com Check certs : 2
- totalnocsupport.co.uk Check certs : 1
- tranquillasupport.co.uk Check certs : 1
- transsupport.co.uk Check certs : 2
- uberridersupport.com Check certs : 1
- venmosupportvenmo.com Check certs : 1
- wagesupport.com Check certs : 2
- your-supporter.net Check certs : 4
- yourbizvasupport.net Check certs : 1
- yousupportedme.net Check certs : 2
Onlyfans Phishing Domains
- best-latina-onlyfans.com Check certs : 2
- bestlatinaonlyfans.com Check certs : 2
- blacksonlyfans.com Check certs : 2
- latina-onlyfans.com Check certs : 2
- onlyfans-latina.com Check certs : 2
- onlyfanschatgpt.com Check certs : 3
- onlyfansgpt.chat Check certs : 3
- onlyfansleais.vip Check certs : 2
- onlyfansleakes.vip Check certs : 2
- onlyfansoneton.com Check certs : 2
- onlyfansraffle.com Check certs : 2
- onlyfansv.com Check certs : 3