Potential Phishing domains for 2023-02-17
Share on:
Feb 18, 2023
Phishing
The following newly registered domains were flagged as potential candidates for phishing campaign hosting
- Copyright (c) 2021 JamesBrine
- Permission is hereby granted, free of charge, to any person obtaining a copy of this list to deal in the list without restriction, including without limtiation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the list, and to permit persons to whom the list is furnished to do so, subject to the following conditions: The above copyright notice and this permission notice shall be included in all copies or substantial portions of the list.
- THE LIST IS PROVIDED ‘AS IS’, WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE LIST OR THE USE OR OTHER DEALINGS IN THE LIST.
NOTICE FOR REMOVAL
- This page is created automaticaly given several factors, textual similarity to known brands/companies, SSL certificate data and provider, open ports, domain registrar and registrant info, on-page content, correlation against prior confirmed phishing campaigns, and so forth. An effort has been made to reduce false positives by appending a score (0-10) using AI/ML modelling. If you believe that your website has been placed on this page by error, please contact me by email with the link above to be considered for removal.
Overview of Phishing Domains by Category
Scores are given from 0-10 using AI/ML, with higher numbers being more likely phishing domains. Domains that are undetermined may be reviewed later.
Facebook Phishing Domains
- drfacebook.com Check certs : 2
- hologramfacebook.com Check certs : 2
Instagram Phishing Domains
- backupinstagram.com Check certs : 2
- fontsinstagram.com Check certs : 2
- freeinstagramfollowers.org Check certs : 2
- hanstagram.com Check certs : 2
- holograminstagram.com Check certs : 2
- instagram-models.com Check certs : 2
- instagramchatgpt.com Check certs : 2
- instagramloeschen.com Check certs : 4
- instagramtalent.com Check certs : 2
Support Phishing Domains
- account-passwordreset.com Check certs : 6
- account-passwordreset.xyz Check certs : 7
- account-signin9.shop Check certs : 8
- ar-signin-upgrade.com Check certs : 2
- designinseconds.com Check certs : 2
- docs-secure-signin.com Check certs : 2
Login-Portal Phishing Domains
- aiblogin.online Check certs : 7
- alisonlogin.com Check certs : 7
- amerisourcebergenlogin.com Check certs : 7
- app-galagames-login-account-acc.com Check certs : 8
- apps-galagames-login-account-accs.com Check certs : 8
- bancobrasil-login3.top Check certs : 8
- bendigoidlogin.com Check certs : 7
- bgcapplogin.com Check certs : 7
- bloging.store Check certs : 7
- capitalonlogin.com Check certs : 7
- cex-login.club Check certs : 6
- cex-login.ink Check certs : 7
- cex-login.wiki Check certs : 6
- cgd-login.com Check certs : 6
- coinbaselogin.com Check certs : 6
- creditcardlogin.live Check certs : 7
- efilelogin.com Check certs : 7
- eu-imaps-login.com Check certs : 8
- gstar28login.fun Check certs : 6
- gstar28login.online Check certs : 6
- gstar28login.space Check certs : 6
- h5-winbox-login.com Check certs : 7
- h5-winboxlogin.com Check certs : 7
- h5winbox-login.com Check certs : 7
- homeauthloginportaldeacesso.digital Check certs : 7
- ip-login.com Check certs : 6
- jkologin.com Check certs : 8
Office365 Phishing Domains
- info-office365.com Check certs : 4
Microsoft Phishing Domains
- aibymicrosoft.com Check certs : 2
Linkedin Phishing Domains
- hologramlinkedin.com Check certs : 2
Dropbox Phishing Domains
- dropbox-plans.com Check certs : 1
- dropboxplans.com Check certs : 1
- dropboxsecure.com Check certs : 4
Adobe Phishing Domains
- adobeadmin.com Check certs : 3
- adobeilllustrator.com Check certs : 4
- adobellustrator.com Check certs : 3
- adoberevise.com Check certs : 2
- adobeuscom.top Check certs : 3
- divadobemestar.online Check certs : 2
- divadobemestar.store Check certs : 2
- hotadobes.com Check certs : 2
Amazon Phishing Domains
- 2for1amazon.com Check certs : 2
- 72hss9amazon.com Check certs : 1
- 883shbwamazon.com Check certs : 1
- 8b73amazon.com Check certs : 1
- ajo22amazon.com Check certs : 1
- ajo78amazon.com Check certs : 1
- ajo82amazon.com Check certs : 1
- allshaizamazonstore.com Check certs : 2
- amazon-ai.live Check certs : 2
- amazon-asia.top Check certs : 3
- amazon-co-jp-z.top Check certs : 3
- amazon-com-jp-z.top Check certs : 3
- amazon-in-iu.top Check certs : 3
- amazon-it-if.top Check certs : 3
- amazon-manage.com Check certs : 3
- amazon-merch.net Check certs : 2
- amazon-merchant.net Check certs : 2
- amazon-mybilling.com Check certs : 6
- amazon-nation.com Check certs : 1
- amazon-tank.com Check certs : 3
- amazon2for1.com Check certs : 2
- amazon68vn.com Check certs : 1
- amazon8888.vip Check certs : 2
- amazonadded.com Check certs : 2
- amazonaiseller.com Check certs : 2
- amazonallservice.online Check certs : 2
- amazonarticles.asia Check certs : 1
- amazonbkingbq.com Check certs : 1
- amazoncreditsolutions.com Check certs : 2
- amazonecjp.top Check certs : 3
- amazonesx.com Check certs : 2
- amazonfindsfriday.com Check certs : 2
- amazonforge.com Check certs : 4
- amazongraphic.shop Check certs : 1
- amazonhjjp.top Check certs : 3
- amazonia-spa.ru Check certs : 2
- amazoniadc.com Check certs : 2
- amazonicarosa.shop Check certs : 1
- amazonkbamwme.com Check certs : 1
- amazonlake.com Check certs : 4
- amazonmallstore.store Check certs : 1
- amazonmanagementagency.com Check certs : 3
- amazonoutfitreviews.com Check certs : 2
- amazonpaintingplus.com Check certs : 3
- amazonpicture.xyz Check certs : 2
- amazonqdajp.top Check certs : 3
- amazonreviewgpt.com Check certs : 1
- amazonsell.pro Check certs : 3
- amazonshopin.com Check certs : 1
- amazonsprime-usa.org Check certs : 2
- amazonstall.com Check certs : 1
- amazonsupport-verify.com Check certs : 8
- amazontepukpi.com Check certs : 1
- amazontheword.com Check certs : 2
- amazontyhuolg.com Check certs : 1
- amazonucdzcok.com Check certs : 1
- amazonvn.store Check certs : 2
- amazonxtra.com Check certs : 2
- amazonyujp.top Check certs : 3
- anc1kamazon.com Check certs : 1
- anc2kamazon.com Check certs : 1
- anc3kamazon.com Check certs : 1
- apsignqu19amazon.com Check certs : 1
- auo9amazon.com Check certs : 3
- bwyu1asd8amazon.com Check certs : 1
- changeaccountsettingamazon.com Check certs : 7
- cilekadek02amazon.com Check certs : 1
- coloska78-amazon.com Check certs : 1
- cuaksj7cuops6amazon.com Check certs : 1
- dofp1oasd9amazon.com Check certs : 1
- dpqk1ad9amazon.com Check certs : 1
- fleamazon.com Check certs : 2
- fuancjsay88-amazon.com Check certs : 1
- ggbgtaya08-amazon.com Check certs : 1
Google Phishing Domains
- acountsgoogle.click Check certs : 2
- acrpropertygoogle.com Check certs : 2
- allgoogles717792081.blog Check certs : 1
- ceshifaguogoogle.bar Check certs : 2
- falconsgoogle.com Check certs : 3
- googie.store Check certs : 3
- google-image-quiz.net Check certs : 2
- google-sapos.com Check certs : 3
- google-tr101.com Check certs : 1
- google-yahoo.ru Check certs : 3
- googlearticles.asia Check certs : 1
- googledigits.com Check certs : 2
- googlematic.com Check certs : 2
- googleshopping.africa Check certs : 4
Banks Phishing Domains
- bendigo-presstitles-au.com Check certs : 1
- bendigodefenceoffshore.com Check certs : 2
- bendigoidlogin.com Check certs : 7
- everyday-wellsfargo-clearaccess.com Check certs : 3
- itservicesbendigo.com Check certs : 1
Games Phishing Domains
- accountminecraft.com Check certs : 7
- advocateblizzard.com Check certs : 3
- alladvancementsinminecraftspeedrun.com Check certs : 2
- alladvancementsminecraftspeedrun.com Check certs : 1
- allepicgames.com Check certs : 1
- best-csgo.ru Check certs : 2
- blizzardreset.com Check certs : 3
- boxbox.store Check certs : 2
- cixboxm.com Check certs : 2
- cocoaluxbox.com Check certs : 5
- csgo-top.ru Check certs : 3
- csgoexchanges.com Check certs : 2
- csgoglow.com Check certs : 2
- ctibia.com Check certs : 3
- darksiders2xbox.com Check certs : 2
- easycsgo.bet Check certs : 3
- fortniteguider.com Check certs : 2
- fortnitescripts.com Check certs : 2
- freefortnite.net Check certs : 2
- go-csgo.ru Check certs : 2
- imba-csgo.ru Check certs : 2
Crypto Phishing Domains
- bi-coinbase.com Check certs : 1
- binance-pendingblock.com Check certs : 3
- binance6.xyz Check certs : 3
- binance888.xyz Check certs : 2
- binancedestekbirimi.com Check certs : 3
- binanceetkinlikkampanyalarsorgulamagirissayfasi.net Check certs : 2
- binanceetkinliklerivekampanyalarigirissayfasikontrol.net Check certs : 2
- binanceetkinliksorgulariyeniyilyenietkinlikler.net Check certs : 2
- binanceetkinlikvekampanyalarinisorgulamasayfamiz.net Check certs : 2
- binanceeventlerimizdenvekapanyalarimizdenhaberdar.net Check certs : 2
- binanceeventlerimizvekampanyalarimizabasvurulariniyapin.net Check certs : 2
- binanceeventlerimizvekampanyalarimizisorgula.net Check certs : 2
- binanceeventlerimveetkinliklerimsayfasisorgulama.net Check certs : 2
- binanceeventlerinisorgulamavekampanyalarakatilma.net Check certs : 2
- binanceeventscampaignschecknewyearsnewcamp.net Check certs : 2
- binanceeventveetkinliklerinegirissayfamizbasvuru.net Check certs : 2
- binanceeventveetkinliklerisorgulamasayfamiz.net Check certs : 2
- binanceeventvekampanyalarigirissayfasisorgulama.net Check certs : 2
- binanceeventvekampanyalarimizabasvurunuzuyapin.net Check certs : 2
- binanceeventvekampanyalarimizdanhaberdaroldunuzmu.net Check certs : 2
- binanceeventvekampanyalarimizdanhaberinizvarmi.net Check certs : 2
- binancenetworkproviders.com Check certs : 3
- binanceneweventkampanyalarilebirliktesorgula.net Check certs : 2
- binanceneweventvecampaignsorgulamalari.net Check certs : 2
- binanceyenietkinliklervekampanyalardanhaberdarol.net Check certs : 2
- binanceyenietkinlikvekampanyalariduyurulari.net Check certs : 2
- binanceyenietkinlikvekampanyalarinisorgulamasayfasi.net Check certs : 2
- binanceyenieventveetkinliklerdenhaberdarolun.net Check certs : 2
- binanceyenieventvekampanyalardanhaberaldinizmi.net Check certs : 2
- binanceyenikampanyalardanveetkinliklerdenhaberinizvarmi.net Check certs : 2
- binanceyeniyiletkinliklerimiz.net Check certs : 2
- binanceyeniyilkampanyalarinisorgula.net Check certs : 2
- bj-coinbase.com Check certs : 1
- bk-coinbase.com Check certs : 1
- bl-coinbase.com Check certs : 1
- bm-coinbase.com Check certs : 1
- bn-coinbase.com Check certs : 1
- bo-coinbase.com Check certs : 1
- coinbase-validate.info Check certs : 3
- coinbaselogin.com Check certs : 6
- coinbaseprola.com Check certs : 2
- coinbasesupport-669-888-8754.com Check certs : 4
Alibaba Phishing Domains
- alibaba-68.xyz Check certs : 2
- alibabatraffic.com Check certs : 2
- alibabautos.com Check certs : 3
- alibabayoe.com Check certs : 2
- alibabayow.com Check certs : 2
www Phishing Domains
- 180www.shop Check certs : 2
- 3885www.app Check certs : 2
- 629www629.com Check certs : 3
- bridgeoverwww.com Check certs : 3
- gangwwwdeng.com Check certs : 1
- httpswwwguoyu.com Check certs : 3
- httpswwwhongkongbabyshop.com Check certs : 1
- httpswwwstackdburgerbar.com Check certs : 2
- jiqiwww.com Check certs : 3
- kkbbwww.com Check certs : 3
Zoom Phishing Domains
- arcazoom.com Check certs : 3
- hookzoomuo.com Check certs : 3
- kinder-zoom.online Check certs : 2
- kinder-zoom.ru Check certs : 2
- kinderzoom.online Check certs : 2
- kinderzoom.ru Check certs : 2
Ryuk Phishing Domains
- 24hritsupport.com Check certs : 3
- absoluteabilitysupport.store Check certs : 2
- accessverificationsupport.org Check certs : 8
- account-support.net Check certs : 7
- aesupports.com Check certs : 1
- aicustomersupports.com Check certs : 2
- aitechsupport.online Check certs : 3
- amazonsupport-verify.com Check certs : 8
- anzdevicesupport.com Check certs : 2
- aquasupport.online Check certs : 1
- arusupport.com Check certs : 2
- astoncounsellingsupport.com Check certs : 1
- atoz-support.com Check certs : 3
- babesupportbabes.com Check certs : 2
- backupinstagram.com Check certs : 2
- banksupportvroom.com Check certs : 2
- barrywhitesupport.com Check certs : 3
- bizsupportforyou.com Check certs : 3
- bnbncesupport.info Check certs : 4
- bookscallsupportquick.live Check certs : 2
- bookscustomersupportquick.live Check certs : 2
- btcturksupport.net Check certs : 1
- business-support.vip Check certs : 2
- c-support-one.com Check certs : 3
- ca-netflxsupport.top Check certs : 3
- cagovssupports.com Check certs : 2
- careersupportllc.com Check certs : 4
- caresupport.live Check certs : 2
- cariboohomesupport.com Check certs : 2
- ch-support.app Check certs : 2
- childsupportmn.com Check certs : 2
- choicessupportservices.com Check certs : 2
- cloud-backup-guide-us.space Check certs : 3
- cloudgatesupport.online Check certs : 1
- cloudimagesupport.com Check certs : 2
- coinbasesupport-669-888-8754.com Check certs : 4
- collinstechsupport.com Check certs : 2
- comcastwebsupport.com Check certs : 1
- conveysupports.online Check certs : 2
- creatorsupport.co.uk Check certs : 1
- crypto-support.xyz Check certs : 2
- crypto-supportinfo.com Check certs : 4
- dashsupportcenter.com Check certs : 2
- desksupportwise.com Check certs : 1
- devitsupport.com Check certs : 2
- divinefitsupport.com Check certs : 3
- divorcesupport.net Check certs : 1
- dragonvartechsupport.com Check certs : 2
- drivertechsupportgrubhub.com Check certs : 2
- eaglehousesupporters.org Check certs : 3
- economybackup.com Check certs : 3
- eliptiksupport.net Check certs : 1
- elvasupport.co.uk Check certs : 2
- equinesupportedwellness.org Check certs : 2
- eurosupport.group Check certs : 2
- fastwebsupport.com Check certs : 3
- federal-canada-support.com Check certs : 1
- fire-insurance-support.com Check certs : 3
- firesupportbase.com Check certs : 2
- freedomsupportfund.com Check certs : 3
- freedomsupportfund.org Check certs : 2
- getsupport-lcloud.com Check certs : 2
- getsupport.download Check certs : 2
- getsupportapplecom.com Check certs : 2
- globalaidsupport.com Check certs : 2
- globalaidsupport.org Check certs : 1
- gmsupportpsionline.com Check certs : 2
- healingsupporttherapy.com Check certs : 2
- hellenic-support.com Check certs : 3
- hrinvestigationsupport.com Check certs : 3
- hvacdigitalsupport.com Check certs : 3
- hypersupporttickets.com Check certs : 2
- immigrationparalegalsupportservices.com Check certs : 8
- inboxsupport.net Check certs : 5
- interiorsupporters.com Check certs : 2
- intuithrsupport.com Check certs : 1
- itscsupport.com Check certs : 3
- itsupportbear.org Check certs : 1
- itsupportcenter.site Check certs : 2
- jpmailback-support.email Check certs : 3
- kansai-ihinseiri-support.com Check certs : 2
- kanto-clear-support.com Check certs : 3
- kinsupport.shop Check certs : 1
- klikbackup.com Check certs : 1
- km-sales-support.com Check certs : 2